Basic Information | |
---|---|
Taxon OID | 2035918001 Open in IMG/M |
Scaffold ID | WWPM1086_GHCZ2246_b1 Open in IMG/M |
Source Dataset Name | Activated sludge microbial communities from Commune de Morges, Switzerland - plasmid pool Visp-2009 (Newbler) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 799 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Aerobic) → Activated Sludge → Wastewater Plasmid Pools → Activated Sludge Microbial Communities From Commune De Morges, Switzerland |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Visp, Switzerland | |||||||
Coordinates | Lat. (o) | 46.30044 | Long. (o) | 7.8594 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F012842 | Metagenome | 277 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
WWPMV_321440 | F012842 | AGAAG | MIVHGCIEIHLKDCGGWIIVMGFRVLLISQHLFPEILLEAVLGIHAGSVKIKSICIQML |
⦗Top⦘ |