NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ZMR_F548DK202HS3LC

Scaffold ZMR_F548DK202HS3LC


Overview

Basic Information
Taxon OID2044078001 Open in IMG/M
Scaffold IDZMR_F548DK202HS3LC Open in IMG/M
Source Dataset NameMaize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Illinois, Urbana-Champaign
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)520
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass, Maize And Miscanthus Rhizosphere → Switchgrass, Maize And Miscanthus Rhizosphere Microbial Communities From University Of Illinois Energy Farm, Urbana, Il

Source Dataset Sampling Location
Location NameUIUC Energy Farm, Urbana, Illinois 61801
CoordinatesLat. (o)40.109Long. (o)-88.204Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015390Metagenome / Metatranscriptome255Y

Sequences

Protein IDFamilyRBSSequence
ZMR_1191940F015390N/ANPILASSTVLFTILFSLVFGIACGYAVISGILHAFARRQVETQAPSTAVIATTVSSH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.