Scaffold PVR_F548DK201ELCT8

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold PVR_F548DK201ELCT8

Scaffold PVR_F548DK201ELCT8

Overview

Basic Information
Taxon OID	2044078004 Open in IMG/M
Scaffold ID	PVR_F548DK201ELCT8 Open in IMG/M
Source Dataset Name	Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Illinois, Urbana-Champaign
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	501
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Switchgrass, Maize And Miscanthus Rhizosphere → Switchgrass, Maize And Miscanthus Rhizosphere Microbial Communities From University Of Illinois Energy Farm, Urbana, Il

Source Dataset Sampling Location
Location Name	UIUC Energy Farm, Urbana, Illinois 61801
Coordinates	Lat. (^o)	40.109722	Long. (^o)	-88.204167	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103523	Metagenome / Metatranscriptome	101	N

Sequences

Protein ID	Family	RBS	Sequence
PVR_914820	F103523	GGAG	MAVGLALIGAAVNRLDLFETLGAETFALAAGFALVLLGVIAIAAYAVVRTIEWANRA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.