Scaffold MiccSOB_F3TY2AH02HH9PU

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold MiccSOB_F3TY2AH02HH9PU

Scaffold MiccSOB_F3TY2AH02HH9PU

Overview

Basic Information
Taxon OID	2046860001 Open in IMG/M
Scaffold ID	MiccSOB_F3TY2AH02HH9PU Open in IMG/M
Source Dataset Name	Concrete drainage pipe biofilm microbial communities from Ohio, US - sample 12382
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	454 Life Sciences
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	517
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm Microbial Communities From Ohio, Us

Source Dataset Sampling Location
Location Name	Ohio, USA
Coordinates	Lat. (^o)	39.8	Long. (^o)	-84.3	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007832	Metagenome / Metatranscriptome	344	Y

Sequences

Protein ID	Family	RBS	Sequence
MiccSOB_15450370	F007832	N/A	VLFLADIFPGGGGPLADVFSLVLAVAMFALLYWLVGLIDRI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.