Basic Information | |
---|---|
Taxon OID | 2046860001 Open in IMG/M |
Scaffold ID | MiccSOB_F3TY2AH02HH9PU Open in IMG/M |
Source Dataset Name | Concrete drainage pipe biofilm microbial communities from Ohio, US - sample 12382 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | 454 Life Sciences |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 517 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm Microbial Communities From Ohio, Us |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Ohio, USA | |||||||
Coordinates | Lat. (o) | 39.8 | Long. (o) | -84.3 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F007832 | Metagenome / Metatranscriptome | 344 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
MiccSOB_15450370 | F007832 | N/A | VLFLADIFPGGGGPLADVFSLVLAVAMFALLYWLVGLIDRI |
⦗Top⦘ |