NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F007832

Metagenome / Metatranscriptome Family F007832

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F007832
Family Type Metagenome / Metatranscriptome
Number of Sequences 344
Average Sequence Length 42 residues
Representative Sequence VLVFADIFPGGGGPLADVFAIAIAVALFALLYWAIDLIDRI
Number of Associated Samples 252
Number of Associated Scaffolds 344

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 42.15 %
% of genes near scaffold ends (potentially truncated) 9.88 %
% of genes from short scaffolds (< 2000 bps) 65.70 %
Associated GOLD sequencing projects 212
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (67.151 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(11.628 % of family members)
Environment Ontology (ENVO) Unclassified
(48.547 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(50.872 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 39.13%    β-sheet: 0.00%    Coil/Unstructured: 60.87%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 344 Family Scaffolds
PF03814KdpA 31.98
PF00486Trans_reg_C 17.15
PF09604Potass_KdpF 14.24
PF13493DUF4118 2.91
PF02518HATPase_c 2.91
PF00702Hydrolase 2.62
PF02669KdpC 1.74
PF01544CorA 1.74
PF12840HTH_20 1.45
PF00582Usp 0.87
PF00122E1-E2_ATPase 0.87
PF00903Glyoxalase 0.87
PF02702KdpD 0.87
PF00912Transgly 0.58
PF01451LMWPc 0.58
PF02566OsmC 0.58
PF13302Acetyltransf_3 0.58
PF04480DUF559 0.58
PF00005ABC_tran 0.58
PF13344Hydrolase_6 0.58
PF12847Methyltransf_18 0.29
PF00072Response_reg 0.29
PF00294PfkB 0.29
PF09678Caa3_CtaG 0.29
PF10590PNP_phzG_C 0.29
PF00188CAP 0.29
PF02649GCHY-1 0.29
PF04299FMN_bind_2 0.29
PF01979Amidohydro_1 0.29
PF00108Thiolase_N 0.29
PF01475FUR 0.29
PF07228SpoIIE 0.29
PF13011LZ_Tnp_IS481 0.29
PF00578AhpC-TSA 0.29
PF07681DoxX 0.29
PF04860Phage_portal 0.29
PF01402RHH_1 0.29
PF00588SpoU_methylase 0.29
PF00392GntR 0.29
PF13784Fic_N 0.29
PF02673BacA 0.29
PF01850PIN 0.29
PF07731Cu-oxidase_2 0.29
PF10011DUF2254 0.29
PF13641Glyco_tranf_2_3 0.29
PF12849PBP_like_2 0.29
PF00809Pterin_bind 0.29
PF13738Pyr_redox_3 0.29
PF01058Oxidored_q6 0.29
PF13683rve_3 0.29
PF03547Mem_trans 0.29
PF01872RibD_C 0.29
PF00690Cation_ATPase_N 0.29
PF00487FA_desaturase 0.29
PF03330DPBB_1 0.29
PF02353CMAS 0.29
PF04116FA_hydroxylase 0.29
PF13473Cupredoxin_1 0.29
PF00361Proton_antipo_M 0.29
PF04545Sigma70_r4 0.29
PF00950ABC-3 0.29
PF03793PASTA 0.29
PF13419HAD_2 0.29
PF00561Abhydrolase_1 0.29
PF08245Mur_ligase_M 0.29

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 344 Family Scaffolds
COG2060K+-transporting ATPase, KdpA subunitInorganic ion transport and metabolism [P] 31.98
COG0598Mg2+ and Co2+ transporter CorAInorganic ion transport and metabolism [P] 1.74
COG2156K+-transporting ATPase, KdpC subunitInorganic ion transport and metabolism [P] 1.74
COG0474Magnesium-transporting ATPase (P-type)Inorganic ion transport and metabolism [P] 1.16
COG2205K+-sensing histidine kinase KdpDSignal transduction mechanisms [T] 0.87
COG2216K+ transport ATPase, ATPase subunit KdpBInorganic ion transport and metabolism [P] 0.87
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.87
COG4953Membrane carboxypeptidase/penicillin-binding protein PbpCCell wall/membrane/envelope biogenesis [M] 0.58
COG5009Membrane carboxypeptidase/penicillin-binding proteinCell wall/membrane/envelope biogenesis [M] 0.58
COG0744Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidaseCell wall/membrane/envelope biogenesis [M] 0.58
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 0.58
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 0.58
COG2230Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferasesLipid transport and metabolism [I] 0.29
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 0.29
COG2340Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domainCell cycle control, cell division, chromosome partitioning [D] 0.29
COG3000Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamilyLipid transport and metabolism [I] 0.29
COG3239Fatty acid desaturaseLipid transport and metabolism [I] 0.29
COG3260Ni,Fe-hydrogenase III small subunitEnergy production and conversion [C] 0.29
COG4270Uncharacterized membrane proteinFunction unknown [S] 0.29
COG4606ABC-type enterochelin transport system, permease componentInorganic ion transport and metabolism [P] 0.29
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 0.29
COG0219tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domainTranslation, ribosomal structure and biogenesis [J] 0.29
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.29
COG0377NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductaseEnergy production and conversion [C] 0.29
COG0565tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferaseTranslation, ribosomal structure and biogenesis [J] 0.29
COG0566tRNA G18 (ribose-2'-O)-methylase SpoUTranslation, ribosomal structure and biogenesis [J] 0.29
COG0609ABC-type Fe3+-siderophore transport system, permease componentInorganic ion transport and metabolism [P] 0.29
COG0679Predicted permease, AEC (auxin efflux carrier) familyGeneral function prediction only [R] 0.29
COG0735Fe2+ or Zn2+ uptake regulation protein Fur/ZurInorganic ion transport and metabolism [P] 0.29
COG1108ABC-type Mn2+/Zn2+ transport system, permease componentInorganic ion transport and metabolism [P] 0.29
COG1398Fatty-acid desaturaseLipid transport and metabolism [I] 0.29
COG1469GTP cyclohydrolase FolE2Coenzyme transport and metabolism [H] 0.29
COG1740Ni,Fe-hydrogenase I small subunitEnergy production and conversion [C] 0.29
COG1941Coenzyme F420-reducing hydrogenase, gamma subunitEnergy production and conversion [C] 0.29
COG1968Undecaprenyl pyrophosphate phosphataseLipid transport and metabolism [I] 0.29
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.29
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 0.29
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.29
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 0.29


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms67.15 %
UnclassifiedrootN/A32.85 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2046860001|MiccSOB_F3TY2AH02HH9PUNot Available517Open in IMG/M
2124908009|FWIRA_GRAM18401DR5L0All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012533Open in IMG/M
2124908028|beta3_all_NODE_170612_len_9082_cov_8_695111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales9132Open in IMG/M
2124908039|B3_v_NODE_6347_len_9050_cov_9_234807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales9100Open in IMG/M
2124908044|A5_c1_ConsensusfromContig35445All Organisms → cellular organisms → Bacteria1827Open in IMG/M
2140918008|ConsensusfromContig297831Not Available603Open in IMG/M
2189573004|GZGWRS401CWTYFAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300000532|CNAas_1018466Not Available504Open in IMG/M
3300001213|JGIcombinedJ13530_101434909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012724Open in IMG/M
3300001213|JGIcombinedJ13530_109298612Not Available569Open in IMG/M
3300001405|JGI20186J14852_1000026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei9034Open in IMG/M
3300001633|JGI20241J16302_100670Not Available846Open in IMG/M
3300001867|JGI12627J18819_10220671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales764Open in IMG/M
3300001979|JGI24740J21852_10134496Not Available616Open in IMG/M
3300002568|C688J35102_120864777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1889Open in IMG/M
3300002906|JGI25614J43888_10038497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1490Open in IMG/M
3300003402|JGI26528J50254_1030422Not Available1281Open in IMG/M
3300003659|JGI25404J52841_10136696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales519Open in IMG/M
3300003911|JGI25405J52794_10061768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales811Open in IMG/M
3300003992|Ga0055470_10000310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4753Open in IMG/M
3300003996|Ga0055467_10139185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012719Open in IMG/M
3300003997|Ga0055466_10088808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei826Open in IMG/M
3300003998|Ga0055472_10133071Not Available726Open in IMG/M
3300004092|Ga0062389_101259087Not Available925Open in IMG/M
3300004635|Ga0062388_102535495Not Available538Open in IMG/M
3300005164|Ga0066815_10013174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1056Open in IMG/M
3300005329|Ga0070683_100003273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales13099Open in IMG/M
3300005329|Ga0070683_100031782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4803Open in IMG/M
3300005332|Ga0066388_102556936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei929Open in IMG/M
3300005332|Ga0066388_105223245Not Available659Open in IMG/M
3300005333|Ga0070677_10000001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales118426Open in IMG/M
3300005335|Ga0070666_10016717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4696Open in IMG/M
3300005335|Ga0070666_10096412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2036Open in IMG/M
3300005336|Ga0070680_100046341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3537Open in IMG/M
3300005337|Ga0070682_100000026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia191388Open in IMG/M
3300005337|Ga0070682_101291856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012620Open in IMG/M
3300005337|Ga0070682_101646371Not Available556Open in IMG/M
3300005337|Ga0070682_101682327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012551Open in IMG/M
3300005340|Ga0070689_100383236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1185Open in IMG/M
3300005347|Ga0070668_101327579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium654Open in IMG/M
3300005355|Ga0070671_100557951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales988Open in IMG/M
3300005356|Ga0070674_100000002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales271088Open in IMG/M
3300005367|Ga0070667_100001291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales22638Open in IMG/M
3300005367|Ga0070667_101231557Not Available701Open in IMG/M
3300005435|Ga0070714_100224669All Organisms → cellular organisms → Bacteria1727Open in IMG/M
3300005435|Ga0070714_100600736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1057Open in IMG/M
3300005436|Ga0070713_100412517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1263Open in IMG/M
3300005437|Ga0070710_11341673Not Available533Open in IMG/M
3300005439|Ga0070711_100084094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2275Open in IMG/M
3300005439|Ga0070711_101617559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300005455|Ga0070663_100002250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei10810Open in IMG/M
3300005455|Ga0070663_100202228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1551Open in IMG/M
3300005459|Ga0068867_101377774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012653Open in IMG/M
3300005535|Ga0070684_100339674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1381Open in IMG/M
3300005539|Ga0068853_100002403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales13996Open in IMG/M
3300005539|Ga0068853_100830262Not Available886Open in IMG/M
3300005544|Ga0070686_100024711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3604Open in IMG/M
3300005547|Ga0070693_101041466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300005548|Ga0070665_100000068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales204531Open in IMG/M
3300005548|Ga0070665_100213473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1931Open in IMG/M
3300005548|Ga0070665_100316111Not Available1566Open in IMG/M
3300005548|Ga0070665_101455927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales694Open in IMG/M
3300005563|Ga0068855_100652675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1130Open in IMG/M
3300005578|Ga0068854_100000044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria91882Open in IMG/M
3300005587|Ga0066654_10000413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales11264Open in IMG/M
3300005614|Ga0068856_100046728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter4263Open in IMG/M
3300005614|Ga0068856_100605148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1117Open in IMG/M
3300005617|Ga0068859_100245568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1880Open in IMG/M
3300005834|Ga0068851_10003190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales7273Open in IMG/M
3300005841|Ga0068863_100000004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria272478Open in IMG/M
3300005842|Ga0068858_100000033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales142748Open in IMG/M
3300005843|Ga0068860_100007463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales10936Open in IMG/M
3300005937|Ga0081455_10101240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD00592312Open in IMG/M
3300005983|Ga0081540_1229085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales657Open in IMG/M
3300006163|Ga0070715_10071182Not Available1554Open in IMG/M
3300006173|Ga0070716_100382721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1006Open in IMG/M
3300006175|Ga0070712_102010196Not Available506Open in IMG/M
3300006578|Ga0074059_11460953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1336Open in IMG/M
3300006579|Ga0074054_12077925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1543Open in IMG/M
3300006604|Ga0074060_11417386Not Available889Open in IMG/M
3300006642|Ga0075521_10268448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales818Open in IMG/M
3300006642|Ga0075521_10367281Not Available698Open in IMG/M
3300006642|Ga0075521_10693303Not Available503Open in IMG/M
3300006854|Ga0075425_100098179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei3327Open in IMG/M
3300006871|Ga0075434_100648345All Organisms → cellular organisms → Bacteria1074Open in IMG/M
3300006881|Ga0068865_101050671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter715Open in IMG/M
3300006903|Ga0075426_10421630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria986Open in IMG/M
3300006954|Ga0079219_10003110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4640Open in IMG/M
3300007822|Ga0104325_110622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D010121204Open in IMG/M
3300009093|Ga0105240_10510293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D010121336Open in IMG/M
3300009098|Ga0105245_10002754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales15803Open in IMG/M
3300009098|Ga0105245_10015680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei6606Open in IMG/M
3300009098|Ga0105245_10147307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2222Open in IMG/M
3300009101|Ga0105247_10001113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia20027Open in IMG/M
3300009148|Ga0105243_13102855Not Available503Open in IMG/M
3300009174|Ga0105241_10016246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5454Open in IMG/M
3300009174|Ga0105241_10647564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012959Open in IMG/M
3300009176|Ga0105242_10000430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales33469Open in IMG/M
3300009176|Ga0105242_10001392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales19052Open in IMG/M
3300009176|Ga0105242_10017159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5637Open in IMG/M
3300009176|Ga0105242_10281201Not Available1511Open in IMG/M
3300009545|Ga0105237_10155990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D010122280Open in IMG/M
3300009551|Ga0105238_10000023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales196844Open in IMG/M
3300009551|Ga0105238_11032650Not Available843Open in IMG/M
3300009551|Ga0105238_12742537Not Available529Open in IMG/M
3300009551|Ga0105238_12764217Not Available527Open in IMG/M
3300009553|Ga0105249_10000074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales145235Open in IMG/M
3300009553|Ga0105249_10128588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2415Open in IMG/M
3300009553|Ga0105249_10561546Not Available1193Open in IMG/M
3300009553|Ga0105249_11364861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012781Open in IMG/M
3300009826|Ga0123355_10964384Not Available913Open in IMG/M
3300010037|Ga0126304_10043799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2693Open in IMG/M
3300010043|Ga0126380_10974952Not Available711Open in IMG/M
3300010048|Ga0126373_10123280Not Available2427Open in IMG/M
3300010051|Ga0133939_1030542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei3861Open in IMG/M
3300010051|Ga0133939_1119771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1031Open in IMG/M
3300010159|Ga0099796_10289026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria692Open in IMG/M
3300010362|Ga0126377_10464202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D010121291Open in IMG/M
3300010362|Ga0126377_10533855All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 811210Open in IMG/M
3300010371|Ga0134125_10001548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales28084Open in IMG/M
3300010371|Ga0134125_10688490Not Available1128Open in IMG/M
3300010371|Ga0134125_10749499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D010121075Open in IMG/M
3300010371|Ga0134125_11474194Not Available741Open in IMG/M
3300010375|Ga0105239_10975608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012974Open in IMG/M
3300010396|Ga0134126_10538702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D010121341Open in IMG/M
3300010397|Ga0134124_12569483Not Available552Open in IMG/M
3300010399|Ga0134127_10359462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D010121426Open in IMG/M
3300010400|Ga0134122_13156457Not Available516Open in IMG/M
3300010401|Ga0134121_11856997All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300011418|Ga0153954_1073640Not Available856Open in IMG/M
3300011418|Ga0153954_1078139Not Available828Open in IMG/M
3300011418|Ga0153954_1162294Not Available555Open in IMG/M
3300012070|Ga0153963_1005393Not Available2628Open in IMG/M
3300012090|Ga0153956_1004957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei7457Open in IMG/M
3300012090|Ga0153956_1007095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5697Open in IMG/M
3300012519|Ga0157352_1055151Not Available603Open in IMG/M
3300012915|Ga0157302_10044150Not Available1234Open in IMG/M
3300012924|Ga0137413_10377565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D010121013Open in IMG/M
3300012924|Ga0137413_10468978Not Available920Open in IMG/M
3300012924|Ga0137413_10856872Not Available702Open in IMG/M
3300012929|Ga0137404_10701920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012915Open in IMG/M
3300012930|Ga0137407_11931038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012563Open in IMG/M
3300012942|Ga0164242_10002654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales20683Open in IMG/M
3300012942|Ga0164242_10355308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D010121088Open in IMG/M
3300012942|Ga0164242_10432591Not Available957Open in IMG/M
3300012943|Ga0164241_10021459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5049Open in IMG/M
3300012943|Ga0164241_10109518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D010121982Open in IMG/M
3300012944|Ga0137410_10248019All Organisms → cellular organisms → Bacteria1394Open in IMG/M
3300012951|Ga0164300_10029736Not Available1993Open in IMG/M
3300012955|Ga0164298_10003714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei5221Open in IMG/M
3300012957|Ga0164303_10981590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012599Open in IMG/M
3300012957|Ga0164303_11070107Not Available580Open in IMG/M
3300012957|Ga0164303_11216420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012552Open in IMG/M
3300012960|Ga0164301_10108745Not Available1610Open in IMG/M
3300012984|Ga0164309_11223216Not Available631Open in IMG/M
3300012985|Ga0164308_10797777Not Available823Open in IMG/M
3300012986|Ga0164304_11613282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012541Open in IMG/M
3300012987|Ga0164307_10025585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3122Open in IMG/M
3300012988|Ga0164306_10196851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 811411Open in IMG/M
3300012988|Ga0164306_10737092Not Available787Open in IMG/M
3300013102|Ga0157371_10002158All Organisms → cellular organisms → Bacteria19158Open in IMG/M
3300013104|Ga0157370_10002243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales23500Open in IMG/M
3300013104|Ga0157370_10565493Not Available1042Open in IMG/M
3300013105|Ga0157369_12565083Not Available516Open in IMG/M
3300013296|Ga0157374_10045144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4077Open in IMG/M
3300013297|Ga0157378_11159635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012811Open in IMG/M
3300013297|Ga0157378_11513506Not Available716Open in IMG/M
3300013306|Ga0163162_10496071All Organisms → cellular organisms → Bacteria1352Open in IMG/M
3300013306|Ga0163162_11140394Not Available884Open in IMG/M
3300013307|Ga0157372_10000923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria32007Open in IMG/M
3300013308|Ga0157375_10000109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales80349Open in IMG/M
3300013308|Ga0157375_11770028Not Available732Open in IMG/M
3300013308|Ga0157375_12159499Not Available663Open in IMG/M
3300013308|Ga0157375_12394682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012630Open in IMG/M
3300013308|Ga0157375_12722057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012591Open in IMG/M
3300013503|Ga0120127_10001129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4478Open in IMG/M
3300014263|Ga0075324_1000008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria104045Open in IMG/M
3300014301|Ga0075323_1069049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012718Open in IMG/M
3300014314|Ga0075316_1121240Not Available639Open in IMG/M
3300014323|Ga0075356_1005108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2094Open in IMG/M
3300014325|Ga0163163_10280816All Organisms → cellular organisms → Bacteria1716Open in IMG/M
3300014326|Ga0157380_13352358Not Available512Open in IMG/M
3300014498|Ga0182019_10151268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D010121470Open in IMG/M
3300014502|Ga0182021_10231848Not Available2161Open in IMG/M
3300014968|Ga0157379_10015509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales6687Open in IMG/M
3300014969|Ga0157376_10325132Not Available1463Open in IMG/M
3300015067|Ga0167640_109507All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81918Open in IMG/M
3300015085|Ga0167632_1004165All Organisms → cellular organisms → Bacteria2131Open in IMG/M
3300015085|Ga0167632_1025058Not Available808Open in IMG/M
3300015090|Ga0167634_1019400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012971Open in IMG/M
3300015197|Ga0167638_1113483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium503Open in IMG/M
3300015264|Ga0137403_10726746All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11852Open in IMG/M
3300015371|Ga0132258_10998093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2115Open in IMG/M
3300015373|Ga0132257_102563986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012663Open in IMG/M
3300017792|Ga0163161_10104649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2110Open in IMG/M
3300017792|Ga0163161_10182473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1610Open in IMG/M
3300017966|Ga0187776_10046200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2466Open in IMG/M
3300017966|Ga0187776_10339432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012988Open in IMG/M
3300018429|Ga0190272_12534481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012559Open in IMG/M
3300018476|Ga0190274_10000661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales20196Open in IMG/M
3300019265|Ga0187792_1547562Not Available619Open in IMG/M
3300019361|Ga0173482_10049061All Organisms → cellular organisms → Bacteria1363Open in IMG/M
3300019377|Ga0190264_10000061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales16218Open in IMG/M
3300019871|Ga0193702_1028413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012716Open in IMG/M
3300019881|Ga0193707_1005223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4555Open in IMG/M
3300019889|Ga0193743_1015477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4106Open in IMG/M
3300019889|Ga0193743_1071840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D010121395Open in IMG/M
3300020001|Ga0193731_1061880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012981Open in IMG/M
3300020021|Ga0193726_1340965Not Available557Open in IMG/M
3300020027|Ga0193752_1041854All Organisms → cellular organisms → Bacteria2035Open in IMG/M
3300020034|Ga0193753_10174481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1005Open in IMG/M
3300020077|Ga0206351_10380487Not Available541Open in IMG/M
3300021181|Ga0210388_10113091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2334Open in IMG/M
3300021339|Ga0193706_1026845Not Available1735Open in IMG/M
3300021401|Ga0210393_11280870Not Available588Open in IMG/M
3300021404|Ga0210389_10613017Not Available855Open in IMG/M
3300021406|Ga0210386_11649455Not Available531Open in IMG/M
3300021418|Ga0193695_1000023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria38800Open in IMG/M
3300021475|Ga0210392_10122240Not Available1744Open in IMG/M
3300021559|Ga0210409_10007985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria10834Open in IMG/M
3300021976|Ga0193742_1155531Not Available683Open in IMG/M
3300022880|Ga0247792_1019048Not Available1130Open in IMG/M
3300023268|Ga0247765_1013967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1811Open in IMG/M
3300024347|Ga0179591_1104507All Organisms → cellular organisms → Bacteria2395Open in IMG/M
3300024978|Ga0209941_1000907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales26147Open in IMG/M
3300024983|Ga0207420_1011744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D010122917Open in IMG/M
3300025321|Ga0207656_10002220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6502Open in IMG/M
3300025504|Ga0208356_1000003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia183985Open in IMG/M
3300025505|Ga0207929_1006264All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 812335Open in IMG/M
3300025625|Ga0208219_1001038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales9796Open in IMG/M
3300025634|Ga0208589_1012730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2524Open in IMG/M
3300025780|Ga0210100_1000094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales18297Open in IMG/M
3300025792|Ga0210143_1052508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012724Open in IMG/M
3300025792|Ga0210143_1092017All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300025792|Ga0210143_1099175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012537Open in IMG/M
3300025878|Ga0209584_10055166Not Available1416Open in IMG/M
3300025893|Ga0207682_10000034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales56869Open in IMG/M
3300025898|Ga0207692_10233779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD00591095Open in IMG/M
3300025899|Ga0207642_10000473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales12319Open in IMG/M
3300025900|Ga0207710_10000154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales73881Open in IMG/M
3300025900|Ga0207710_10200964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012984Open in IMG/M
3300025900|Ga0207710_10641014Not Available556Open in IMG/M
3300025900|Ga0207710_10644274Not Available555Open in IMG/M
3300025903|Ga0207680_10439728Not Available925Open in IMG/M
3300025911|Ga0207654_10011343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4547Open in IMG/M
3300025911|Ga0207654_11348838Not Available520Open in IMG/M
3300025912|Ga0207707_10141603Not Available2103Open in IMG/M
3300025914|Ga0207671_10499588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012970Open in IMG/M
3300025915|Ga0207693_10940438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium662Open in IMG/M
3300025916|Ga0207663_10894682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria710Open in IMG/M
3300025917|Ga0207660_10541292Not Available947Open in IMG/M
3300025921|Ga0207652_10007488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales8795Open in IMG/M
3300025923|Ga0207681_10277555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D010121318Open in IMG/M
3300025924|Ga0207694_10000004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales967075Open in IMG/M
3300025924|Ga0207694_10531851Not Available986Open in IMG/M
3300025927|Ga0207687_10004229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales9596Open in IMG/M
3300025927|Ga0207687_10012948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei5449Open in IMG/M
3300025928|Ga0207700_10054138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3010Open in IMG/M
3300025928|Ga0207700_11628449Not Available571Open in IMG/M
3300025929|Ga0207664_10057178All Organisms → cellular organisms → Bacteria3100Open in IMG/M
3300025929|Ga0207664_10400455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. W3-3-21221Open in IMG/M
3300025931|Ga0207644_11226140Not Available631Open in IMG/M
3300025934|Ga0207686_10000033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales143602Open in IMG/M
3300025934|Ga0207686_10000815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales19044Open in IMG/M
3300025934|Ga0207686_10089709Not Available2027Open in IMG/M
3300025936|Ga0207670_10315489Not Available1229Open in IMG/M
3300025937|Ga0207669_10000003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales252239Open in IMG/M
3300025937|Ga0207669_10817773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium774Open in IMG/M
3300025938|Ga0207704_10000079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria58183Open in IMG/M
3300025938|Ga0207704_10753392Not Available810Open in IMG/M
3300025938|Ga0207704_11485634Not Available581Open in IMG/M
3300025944|Ga0207661_10001795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales14672Open in IMG/M
3300025961|Ga0207712_10000007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia539589Open in IMG/M
3300025961|Ga0207712_10308193Not Available1302Open in IMG/M
3300025961|Ga0207712_10404198Not Available1148Open in IMG/M
3300025981|Ga0207640_10000094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria70117Open in IMG/M
3300025981|Ga0207640_10029655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei3361Open in IMG/M
3300026035|Ga0207703_10000310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales52770Open in IMG/M
3300026035|Ga0207703_10000577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales37419Open in IMG/M
3300026035|Ga0207703_10239005Not Available1632Open in IMG/M
3300026041|Ga0207639_10010610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei6381Open in IMG/M
3300026041|Ga0207639_10364507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D010121294Open in IMG/M
3300026067|Ga0207678_10266954Not Available1467Open in IMG/M
3300026067|Ga0207678_11663045All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300026078|Ga0207702_10029555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4561Open in IMG/M
3300026078|Ga0207702_10365250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD00591384Open in IMG/M
3300026088|Ga0207641_10000170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria91128Open in IMG/M
3300026911|Ga0209620_1022615Not Available564Open in IMG/M
3300027002|Ga0209110_1003718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D010121572Open in IMG/M
3300027037|Ga0209005_1046320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012535Open in IMG/M
3300027058|Ga0209111_1036604Not Available620Open in IMG/M
3300027288|Ga0208525_1037420Not Available599Open in IMG/M
3300027496|Ga0208987_1043819Not Available799Open in IMG/M
3300027504|Ga0209114_1057074Not Available691Open in IMG/M
3300027517|Ga0209113_1016431Not Available963Open in IMG/M
3300027524|Ga0208998_1022284Not Available999Open in IMG/M
3300027524|Ga0208998_1023562Not Available972Open in IMG/M
3300027559|Ga0209222_1072083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium665Open in IMG/M
3300027775|Ga0209177_10001010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4755Open in IMG/M
3300027815|Ga0209726_10304948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012776Open in IMG/M
3300027817|Ga0209112_10079263Not Available1039Open in IMG/M
3300027817|Ga0209112_10203639Not Available681Open in IMG/M
3300027817|Ga0209112_10216590Not Available662Open in IMG/M
3300027895|Ga0209624_10020575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei4177Open in IMG/M
3300028379|Ga0268266_11058629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales785Open in IMG/M
3300028379|Ga0268266_11412905All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300028381|Ga0268264_10005373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales10850Open in IMG/M
3300028536|Ga0137415_10251123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D010121578Open in IMG/M
3300028556|Ga0265337_1000074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria46897Open in IMG/M
3300028558|Ga0265326_10217170Not Available550Open in IMG/M
3300028573|Ga0265334_10268257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012586Open in IMG/M
3300028793|Ga0307299_10108178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D010121041Open in IMG/M
3300028800|Ga0265338_10000441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia74208Open in IMG/M
3300028802|Ga0307503_10000027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia137045Open in IMG/M
3300028802|Ga0307503_10448023All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81685Open in IMG/M
3300028875|Ga0307289_10112106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD00591115Open in IMG/M
3300028875|Ga0307289_10451211Not Available528Open in IMG/M
3300030336|Ga0247826_11072722Not Available642Open in IMG/M
3300031003|Ga0074003_13505997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D010121083Open in IMG/M
3300031170|Ga0307498_10443603Not Available519Open in IMG/M
3300031184|Ga0307499_10067338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium916Open in IMG/M
3300031198|Ga0307500_10009779All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 31957Open in IMG/M
3300031226|Ga0307497_10232800Not Available814Open in IMG/M
3300031712|Ga0265342_10361718Not Available754Open in IMG/M
3300031715|Ga0307476_10002146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales11798Open in IMG/M
3300031740|Ga0307468_101365090Not Available649Open in IMG/M
3300031918|Ga0311367_11318886Not Available713Open in IMG/M
3300031996|Ga0308176_11937240Not Available629Open in IMG/M
3300032205|Ga0307472_100107993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD00591934Open in IMG/M
3300032205|Ga0307472_100733894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012893Open in IMG/M
3300032205|Ga0307472_101385060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012681Open in IMG/M
3300032770|Ga0335085_10367805Not Available1680Open in IMG/M
3300032805|Ga0335078_11125431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria915Open in IMG/M
3300032829|Ga0335070_10000184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia71249Open in IMG/M
3300032829|Ga0335070_10418552All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1279Open in IMG/M
3300032829|Ga0335070_10497871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D010121155Open in IMG/M
3300032829|Ga0335070_12090720Not Available508Open in IMG/M
3300032896|Ga0335075_10036738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei6985Open in IMG/M
3300032896|Ga0335075_11383189Not Available595Open in IMG/M
3300032954|Ga0335083_10000500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales59898Open in IMG/M
3300032955|Ga0335076_11532745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → unclassified Patulibacter → Patulibacter sp. SYSU D01012554Open in IMG/M
3300033433|Ga0326726_10850148Not Available884Open in IMG/M
3300034268|Ga0372943_0277517Not Available1059Open in IMG/M
3300034965|Ga0370497_0000441All Organisms → cellular organisms → Bacteria7331Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.63%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.65%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.36%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.36%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere4.07%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.78%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.49%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.49%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.62%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.62%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.33%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.91%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.74%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens1.74%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil1.45%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.45%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.45%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.45%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.45%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil1.16%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.16%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.16%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.16%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.16%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.16%
CompostEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Compost0.87%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.87%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.87%
Wastewater BioreactorEngineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor0.87%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.58%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.58%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.58%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.58%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.58%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.58%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.58%
Industrial WastewaterEngineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater0.58%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.29%
Concrete Drainage Pipe BiofilmEnvironmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm0.29%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.29%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.29%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.29%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.29%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.29%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.29%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.29%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.29%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.29%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.29%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.29%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.29%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.29%
Quercus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere0.29%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.29%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2046860001Concrete drainage pipe biofilm microbial communities from Ohio, US - sample 12382EnvironmentalOpen in IMG/M
2124908009Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2EnvironmentalOpen in IMG/M
2124908028Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3EnvironmentalOpen in IMG/M
2124908039Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4EnvironmentalOpen in IMG/M
2124908044Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5EnvironmentalOpen in IMG/M
2140918008Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_allEnvironmentalOpen in IMG/M
2189573004Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen)EnvironmentalOpen in IMG/M
3300000532Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_AssembledHost-AssociatedOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001405Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012EnvironmentalOpen in IMG/M
3300001633Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF007EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300001979Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6Host-AssociatedOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300002906Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cmEnvironmentalOpen in IMG/M
3300003402Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_solids_1EngineeredOpen in IMG/M
3300003659Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300003911Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300003992Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1EnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300003997Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1EnvironmentalOpen in IMG/M
3300003998Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007822Permafrost core soil microbial communities from Svalbard, Norway - sample 2-8-2 SoapdenovoEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010051Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196EngineeredOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011418Attine ant fungus gardens microbial communities from Florida, USA - TSFL038 MetaGHost-AssociatedOpen in IMG/M
3300012070Attine ant fungus gardens microbial communities from Florida, USA - TSFL047 MetaGHost-AssociatedOpen in IMG/M
3300012090Attine ant fungus gardens microbial communities from Florida, USA - TSFL040 MetaGHost-AssociatedOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012942Miracle-Growth compost microbial communities from Emeryville, California, USA - Original compost - Miracle growth compost (MG)EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013503Permafrost microbial communities from Nunavut, Canada - A23_5cm_12MEnvironmentalOpen in IMG/M
3300014263Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1EnvironmentalOpen in IMG/M
3300014301Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1EnvironmentalOpen in IMG/M
3300014314Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2EnvironmentalOpen in IMG/M
3300014323Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015067Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7A, Adjacent to main proglacial river, mid transect (Watson river))EnvironmentalOpen in IMG/M
3300015085Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake)EnvironmentalOpen in IMG/M
3300015090Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5A, Northern proglacial tributary margin, adjacent to top of river)EnvironmentalOpen in IMG/M
3300015197Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019265Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019871Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a1EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300019889Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020027Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1EnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300020077Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021339Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021418Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2EnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021976Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c1EnvironmentalOpen in IMG/M
3300022880Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6EnvironmentalOpen in IMG/M
3300023268Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L106-311C-6EnvironmentalOpen in IMG/M
3300024347Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300024978Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_solids_1 (SPAdes)EngineeredOpen in IMG/M
3300024983Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_inoc_biof (SPAdes)EngineeredOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025504Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025505Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025625Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025634Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025780Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025792Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026911Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027002Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027037Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027058Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027288Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes)EnvironmentalOpen in IMG/M
3300027496Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027504Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027517Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027524Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027559Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027817Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028556Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaGHost-AssociatedOpen in IMG/M
3300028558Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaGHost-AssociatedOpen in IMG/M
3300028573Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaGHost-AssociatedOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031003Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-3A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M
3300034965Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MiccSOB_154503702046860001Concrete Drainage Pipe BiofilmVLFLADIFPGGGGPLADVFSLVLAVAMFALLYWLVGLIDRI
FWIRA_055238802124908009SoilLSFLADIFPGGGSPAADVFAIAIAVVLFALLYWAIDLIDRI
beta3_all_011632702124908028SoilMIVAMLSAADIFPGGGGPLADVFAIAIAVGLFALLYWAIDLIDRI
B3_v_003331802124908039SoilMIVAMLSAADIFPGGGGPLADVFAIAIAVGLFALLYWAIGLIDRI
A5_c1_007253802124908044SoilLFTPADIFPGGGSPIADVFAIAIAVGIFALLYWAIDLIDRI
Bog_all_C_056712402140918008SoilPVTFLADIFPGGGSPLADVFAIAIAVGLFALLYWAIDLIDRI
FG2_077434602189573004Grass SoilVVSFADIFPGGGGPIADVFAIALSVGLFALVYWAIDLIDRI
CNAas_101846613300000532Quercus RhizosphereVPFLADIFPGGGGPLADLFAVAIAVGLFALLYWAIDLIDRI*
JGIcombinedJ13530_10143490923300001213WetlandMISAVLVPADIFPGGGSPIADVFAIVLSVGLFALIFWAIDLIDRI*
JGIcombinedJ13530_10929861213300001213WetlandVLYVLADLFPGGGSPVADVFAIAIAVALFALLYWAIDLIERI*
JGI20186J14852_100002693300001405Arctic Peat SoilVLVVLSDIFPGGGGPLADVFAIAIAVALFALLYWAIDLIDRI*
JGI20241J16302_10067023300001633Forest SoilVLFLADIFPGGGSPIADVFSIAIAIAMFALLYWLISLIDRI*
JGI12627J18819_1022067133300001867Forest SoilVLFLADIFPGGGSPLADVFSIAIAIAMFALLYWLISLIDRI*
JGI24740J21852_1013449633300001979Corn RhizosphereRVLFLADIFPGGDSPIADVCAIGIALVLFALLFCAIDLIDRI*
C688J35102_12086477723300002568SoilVFVLADIFPGGGSPLADAFSIAIAIVLFALLYLSIELIDRV*
JGI25614J43888_1003849723300002906Grasslands SoilVLFVLADLFPGGGSPLADVFAIAIAVALFALLYWAIDLIDRI*
JGI26528J50254_103042213300003402Wastewater BioreactorVLFLADIFPGGGSPVADVFAIAIALFLFALLFWVIDLIDRI*
JGI25404J52841_1013669623300003659Tabebuia Heterophylla RhizosphereVLFLADIFPGGGGPAADVFSIAIAIAMFALLYWLISLIDRI*
JGI25405J52794_1006176823300003911Tabebuia Heterophylla RhizosphereVLLSANIFPGGGGIPADLFAIFCAVVLFALLLWAIDLIDRI*
Ga0055470_1000031043300003992Natural And Restored WetlandsVFAPADIFPGGGSPIADVFAIVVSVALFALVYWAIDRIDRI*
Ga0055467_1013918523300003996Natural And Restored WetlandsVLFVFADIFPGGGSPIADVFAIALSVGLFALVYWAIDLIDRI*
Ga0055466_1008880823300003997Natural And Restored WetlandsVISVLADLFPGGGSPLADLFAIVVSAALFALILWAVDLIDRI*
Ga0055472_1013307113300003998Natural And Restored WetlandsMIAVVLVLADIFPGGGSPIADVFAIALSVGLFALVYWAIDLIDRI*
Ga0062389_10125908723300004092Bog Forest SoilVLFLADIFPGGGGPLADLFAVALAVVLFALLYWAIDLIDRI*
Ga0062388_10253549513300004635Bog Forest SoilLFWSANIFPGGGGPLADAFAIAIAVVIFALLYWAIDLIDRI*
Ga0066815_1001317423300005164SoilVLSFADIFPGGGSPIADAFAIALSVGLFGLVYWAIDLIDRI
Ga0070683_10000327343300005329Corn RhizosphereVLSFADIFPGGGGLPADLLALAIAVALFALLYWAIELIDRI*
Ga0070683_10003178253300005329Corn RhizosphereVLLLADIFPGGGSPIADVCAIGIALVLFALLFCAIDLIDRI*
Ga0066388_10255693623300005332Tropical Forest SoilVLSVLADVFPGGGGPLADAFAIAIAVGIFALLYWAIDLIDRI*
Ga0066388_10522324523300005332Tropical Forest SoilVLSILDIAPLADLFPGGGGPLADAFAIALAVALFALLYWAIDLIDRI*
Ga0070677_10000001983300005333Miscanthus RhizosphereVNDGPVLSSADIFPGGGGPLADLVAIALAVGLFALLYWAIDLIDRI*
Ga0070666_1001671713300005335Switchgrass RhizosphereVLFLADIFPGGGSPVADVFAIAIAFVLFALLFWAIDLIDRI*
Ga0070666_1009641223300005335Switchgrass RhizosphereVSSFAHLLSAADIFPGGGSPVADLFSIVLAIAMFALLYWLISLIDRI*
Ga0070680_10004634133300005336Corn RhizosphereVPSFADIFSGGGGLPADLFAVAVATALFTLLCWAIELIDRI*
Ga0070682_1000000261143300005337Corn RhizosphereVLLFANLFPGGGGPLADVFSVGIAIVLFALLYWAVELIDRI*
Ga0070682_10129185623300005337Corn RhizosphereVGAHDARVSSFAHLLSAADIFPGGGSPVADLFSIAIAVVMFAALYWLISLIDRI*
Ga0070682_10164637123300005337Corn RhizosphereVLSIVPLADLFPGGGTPVADVFAIALAIGLFALLYWAIDLVDRI*
Ga0070682_10168232723300005337Corn RhizosphereVLFLADIFPGGGGPLADVLAIAIALVLFALLYWAIDLIERI*
Ga0070689_10038323623300005340Switchgrass RhizosphereVVPFANLFPGGGSPVADVFSIALAVVLFALLYWAIDLIDRI*
Ga0070668_10132757913300005347Switchgrass RhizosphereVLVIANIFPGGGGVPADLVAVVVALVTFAVLYLAIDLIDRI*
Ga0070671_10055795123300005355Switchgrass RhizosphereVLFLADIFPGGGGPLADVLAIAIAVGLFAVLYWAIDLIDRI*
Ga0070674_100000002443300005356Miscanthus RhizosphereVLSFADIFPGGGGPLADAVAISLSVCLFGLVYWAIDLIDRI*
Ga0070667_100001291173300005367Switchgrass RhizosphereVFVGADIFPGGGSPIADLFSILLAVGLFALLYWAIGLIDRI*
Ga0070667_10123155733300005367Switchgrass RhizosphereVLFLADIFPGGGGIAADAFSIAIAIAMFAVLYWLIGLIDRI*
Ga0070714_10022466923300005435Agricultural SoilVFVCADLFPGGGGPLADAFSIALAVILFALLYWAIDLIDRI*
Ga0070714_10060073623300005435Agricultural SoilVVSVADIFPGGGGPLADVFAIAIAIGLFALLYWAIDLIDRI*
Ga0070713_10041251723300005436Corn, Switchgrass And Miscanthus RhizosphereVVPFANLFPGGGSPLADVFSIALAVILFALLYWAIDLIDRI*
Ga0070710_1134167313300005437Corn, Switchgrass And Miscanthus RhizosphereMLVPADIFPGGGGPVADVFAIALSVALFALIFWAIDLIDRI*
Ga0070711_10008409433300005439Corn, Switchgrass And Miscanthus RhizosphereVVPFANLFPGGGSPLADVFSIALAVVLFALLYWAIDLIDRI*
Ga0070711_10161755923300005439Corn, Switchgrass And Miscanthus RhizosphereVVPFANLFPGGGSPVADVFSIVLAVILFALLYWAIDLIDRI*
Ga0070663_10000225053300005455Corn RhizosphereVLFLADIFPGGDSPIADVCAIGIALVLFALLFCAIDLIDRI*
Ga0070663_10020222823300005455Corn RhizosphereVLSVLADIFPGGGGPLADVFSVAIAIGLFALLYWAIDLIDRV*
Ga0068867_10137777423300005459Miscanthus RhizosphereVFVFSDLFPGGGSPLADLFSVALAVVLFALLYWAIDLIDRI*
Ga0070684_10033967423300005535Corn RhizosphereVLVRLADIFPGGGGPLADVFSVALALVLFALLYWAIDLIDRI*
Ga0068853_10000240343300005539Corn RhizosphereVLSFADIFPGGGGLPADLFALAIAVALFALLYGAIELIDRI*
Ga0068853_10083026223300005539Corn RhizosphereVFVCGNIFPGGGSPLADLFSIALAVILFALLYWAIDLIDRI*
Ga0070686_10002471123300005544Switchgrass RhizosphereVLSVLADIFPGGGGPLADVFAIAIAVGLFALLYWAIDLIDRI*
Ga0070693_10104146623300005547Corn, Switchgrass And Miscanthus RhizosphereVFVCADLFPGGGGLLADAFSIALAVGLFALLYWAIDLIDRI*
Ga0070665_1000000681833300005548Switchgrass RhizosphereVLSFADILPGGGGLPADLLAVAIAVALFALLYWAIELIDRI*
Ga0070665_10021347313300005548Switchgrass RhizosphereVLFLADIFPGGGGPVADVFSIAIAVAMFAVLYWLISLIDRI*
Ga0070665_10031611113300005548Switchgrass RhizosphereVLFVLADIFPGGGGPAADAFAIAIALALFALLYWAIDLIDRI*
Ga0070665_10145592713300005548Switchgrass RhizosphereVLLLADIFPGGGGPVADVFSIAIAIAMFAVLYWLISLIDRI*
Ga0068855_10065267533300005563Corn RhizosphereVPSFADIFSGGGGLPADLFAIAVATALFALLYWAIELIDRI*
Ga0068854_100000044833300005578Corn RhizosphereVFVCADLFPGGGSPVADVFSIALAVILFALLYWAVELIDRI*
Ga0066654_1000041343300005587SoilVPSFADIFPGGGGLPADLFAVAIAVALFALLYWAIELIDRI*
Ga0068856_10004672833300005614Corn RhizosphereVLSLADIFPGGGGPAADFLAVAIAVALFALLYGAIELIDRI*
Ga0068856_10060514823300005614Corn RhizosphereVLFLADIFPGGGSPIADVFAIAIALVLFALLFWAIDLIDRI*
Ga0068859_10024556833300005617Switchgrass RhizosphereVLFLADIFPGGGGPLADVLAIAIAVGLFALLYWAIDLIDRI*
Ga0068851_1000319033300005834Corn RhizosphereVLLFANLFPGGGGPLADVFSIAIAVVLFVALYWAVELIDRI*
Ga0068863_1000000041593300005841Switchgrass RhizosphereVLSFADIFPGGSGVLADLFAVAIAVALFAFLYWAIDLIERI*
Ga0068858_100000033413300005842Switchgrass RhizosphereVLSVLADIFPGGGGPLADVFSIAIAIGLFALLYWAIELIDRV*
Ga0068860_10000746353300005843Switchgrass RhizosphereVLSFIADIFPGGGSPLADAFAIALSVGLFALVFWAIDLIDRI*
Ga0081455_1010124033300005937Tabebuia Heterophylla RhizosphereVLFLADIFPGGGSPVADVFSIAIAVAMFAVLYWLISLIDRI*
Ga0081540_122908513300005983Tabebuia Heterophylla RhizosphereVFVLANLFPGGGSPVADAFSIALAVALFALLYWAIDLIDRI*
Ga0070715_1007118213300006163Corn, Switchgrass And Miscanthus RhizosphereVLSFANLFPGGGGPLADVFSVAIAVVLFAALYWAVELIDRI*
Ga0070716_10038272133300006173Corn, Switchgrass And Miscanthus RhizosphereVLSFADIFPGGGGLSADLFSIAIAVGLFALLYWAIDLID
Ga0070712_10201019613300006175Corn, Switchgrass And Miscanthus RhizosphereVFVCADLFPGGGGPLADVFSIALAVILFALLYWAIELIDRI*
Ga0074059_1146095333300006578SoilLFADIFPGGGGLAADLFAVAIAVALFALLYWAIELIDRI*
Ga0074054_1207792533300006579SoilVLSFADIFPGGGSPIADAFAIALSVGLFGLVYWAIDLIDRI*
Ga0074060_1141738623300006604SoilMLLLADLFPGGGPLADLFAVAIAVALFALLYWAIDLIERI*
Ga0075521_1026844833300006642Arctic Peat SoilVLVLSDIFPGGGGPLADVFAVAIAIGLFALLYWAIDLIDRI*
Ga0075521_1036728123300006642Arctic Peat SoilVIFLSDIFPGGGGPLADVFAIAIALVLFALLYWAIDLID
Ga0075521_1069330323300006642Arctic Peat SoilVLFLADIFPGGGGPLADVLAVAIALVLFALLYWAIDLIDRI*
Ga0075425_10009817933300006854Populus RhizosphereVFSFADIFPGGGSPIADVFAIALSVGLFALVYWAIDLIDRI*
Ga0075434_10064834533300006871Populus RhizosphereVLSLADIFPGGGGPLADLFAIALAAGLFALLYWAIDLIDRI*
Ga0068865_10105067123300006881Miscanthus RhizosphereVPSFADIFPGGGGLPADFLAVAIAVALFALLYWAIDLIERI*
Ga0075426_1042163023300006903Populus RhizosphereVFVCADLFPGGGGPFADVFSIALAVVLFALLYWAIELIDRI*
Ga0079219_1000311053300006954Agricultural SoilVLSFADIFPGGGSPVADVISIALALLMFALLYWGIDLIDRI*
Ga0104325_11062223300007822SoilLSTAADIFPGGGGLPADLFAVAIAVALFALLYWAIGLIDRI*
Ga0105240_1051029333300009093Corn RhizosphereVSSFAHLLSAADIFPGGGSPAADLFSIAIAVVMFAALYWLISLIDRI*
Ga0105245_1000275493300009098Miscanthus RhizosphereVFVCADLFPGGGSPVADVFSIALAVILFALLYWAIELIDRI*
Ga0105245_1001568053300009098Miscanthus RhizosphereVPSFADIFPGSGGLPADLLALAIAVALFALLYWAIELIDRI*
Ga0105245_1014730723300009098Miscanthus RhizosphereMLTIANIFPGGGGVPADIFAVVVALVTFAVLYVAIDLIDRI*
Ga0105247_10001113223300009101Switchgrass RhizosphereVLVRLADIFPGGGGPLADVLAIAIAVALFALLYWAIDLIERI*
Ga0105243_1310285533300009148Miscanthus RhizosphereIFPSGGGLPADLLAVAIAVALFALLYWAIELIDRI*
Ga0105241_1001624643300009174Corn RhizosphereVFVCADLFPGGGGPLADVFSIALAVALFALLYWAIELIDRI*
Ga0105241_1064756423300009174Corn RhizosphereVSSFAHLLSAADIFPGGGSPVADLFSIAIAVVMFAALYWLISLIDRI*
Ga0105242_10000430213300009176Miscanthus RhizosphereVLLFADIFPGGGGPLADLLAVAIALVLFALLYWAIDLIERI*
Ga0105242_1000139233300009176Miscanthus RhizosphereVLVCLADIFPGGGGPLADVLAIVLAVALFALLYWAIDLIDRI*
Ga0105242_1001715913300009176Miscanthus RhizosphereVLSVLADIFPGGGGPLADAFSIAIAIGLFALIYWAIDLIDRV*
Ga0105242_1028120113300009176Miscanthus RhizosphereVLSFADIFPGGGGLPADIFAVAIAVALFALLYWAIELIDRI*
Ga0105237_1015599033300009545Corn RhizosphereVSSFAHLLSVADIFPGGGSPVADLFSIAIAVVMFAALYWLVSLIDRI*
Ga0105238_10000023873300009551Corn RhizosphereVLSLADIFPGGGGPIADVFAIALSVGLFALVSWAIELIDRI*
Ga0105238_1103265023300009551Corn RhizosphereVSSFAHLLSAADIFPGGGSPVADLFSIAIAVVMFAALYWLVSLIDRI*
Ga0105238_1274253723300009551Corn RhizosphereVNDGLVLSFADIFPGGGGPPADAFAIALAVGLFGLLYWAIDLIDRI*
Ga0105238_1276421733300009551Corn RhizosphereLADIFPGGGGPVADVFSIAIAIAMFALLYWLISLIDRI*
Ga0105249_10000074353300009553Switchgrass RhizosphereVLSFADIFPGGGGPLADLFAIALAVGLFALLYWAIDLIDRV*
Ga0105249_1012858833300009553Switchgrass RhizosphereVLSLADIFPGGGGLPADLFAVAIAVGLFALLYWAIELIDRI*
Ga0105249_1056154613300009553Switchgrass RhizosphereVLSVLADIFPGGGSPVADVFAVAIAVALFALLYWAIDLIDRI*
Ga0105249_1136486123300009553Switchgrass RhizosphereVLFLADIFPGGGSPVADLFSIVLAIAMFALLYWLISLIDRI*
Ga0123355_1096438433300009826Termite GutVLSLAHLTTLADIFPGGGSPVADLFAIVLAVLMFGFLYWLIALIDRI*
Ga0126304_1004379913300010037Serpentine SoilDIFPGGGSPLADAVAIAIAVALFALLYLSIELIDHV*
Ga0126380_1097495223300010043Tropical Forest SoilVFVCADLFPGGGSPVADVFSIALAVVLFALLYWAIELIDRI*
Ga0126373_1012328023300010048Tropical Forest SoilVLVPANLFPGGGGPVADVFSIALAVVLFALLYWRIELIDRI*
Ga0133939_103054243300010051Industrial WastewaterVLLSADIFPGGGGIPADLFSIFCAVVLFALLYWAIDLIDRI*
Ga0133939_111977113300010051Industrial WastewaterVLFGADIFPGGGGVPADAFAILCAVVLFALLFWAIELIDRI*
Ga0099796_1028902623300010159Vadose Zone SoilVLLFADIFPGGGSPLADVFAVVVALILFALLYWAIDLIDRI*
Ga0126377_1046420233300010362Tropical Forest SoilVLSFADIFPGGGSPLADLFSVALAVGLFALLYWAIDLIDRI*
Ga0126377_1053385513300010362Tropical Forest SoilFADIFPGGGSPLADVFAIALSVGLFALVYWAIELIDRL*
Ga0134125_10001548203300010371Terrestrial SoilVLYLADIFPGGGSPVADLFSIVLAIAMFALLYWLVSLIDRI*
Ga0134125_1068849013300010371Terrestrial SoilVLFLADIFPGGGSPVADLFSIVLGIAMFALLYWLISLIDRI*
Ga0134125_1074949923300010371Terrestrial SoilVLSFADIFPGGGGPLADVISIALAVGLFALLYWAIELIDRI*
Ga0134125_1147419413300010371Terrestrial SoilVLIGADIFPGGGGLPADLFAILCAVVLFALLFWAIDLIDRI*
Ga0105239_1097560823300010375Corn RhizosphereVLSFADIFPGGGGPIADVFAVALSVGLFALVYWAIELIDRI*
Ga0134126_1053870233300010396Terrestrial SoilLLADIFPGGGSPIADVFSIAIAIAMFALLYWLISLIDRI*
Ga0134124_1256948313300010397Terrestrial SoilVLFLADIFPGGGGPFADVFSIAIAIAMFALLYWLVSLIDRI*
Ga0134127_1035946223300010399Terrestrial SoilVPFLGDIFPGGGGPAADVFSIAIAVGMFAVLYWLISLIDRI*
Ga0134122_1315645733300010400Terrestrial SoilVIANIFPGVGGVPADLVAVVVALVTFAVLYLAIDLIDRI*
Ga0134121_1185699723300010401Terrestrial SoilVLFLADIFPGGGGPVADVFSIAIAIAMFALLYWLISLIDRI*
Ga0153954_107364013300011418Attine Ant Fungus GardensVLFLADIFPGGGSPLADVFSIALAIAMFALLYWLIALIDRI*
Ga0153954_107813923300011418Attine Ant Fungus GardensVLFLADIFPGGGSPVADLFSIALAVIMFALLYWLIGLIDRI*
Ga0153954_116229423300011418Attine Ant Fungus GardensVLSLADIFPGGGSPIADMFSIALAVVMFALLYWLVSLIDRI*
Ga0153963_100539333300012070Attine Ant Fungus GardensVNDGLVLSLADIFPGGGSPLADAFSIALAVGLFALLYWAIDLIDRI*
Ga0153956_100495723300012090Attine Ant Fungus GardensVLFLADIFPGGGSPLADVFAIVIALVLFALLFWAIDLIDRI*
Ga0153956_100709523300012090Attine Ant Fungus GardensVTSFAHLLSAADIFPGGGSPVADLFSVALAVVMFALLYWLIGLIDRI*
Ga0157352_105515133300012519Unplanted SoilRSVFVLADIFPGGGSPLADAFAIAIAVLLFAFVYLSIELIDRV*
Ga0157302_1004415023300012915SoilVVHDRYVSLFADLFPSGGFQADALAIGIAVCLFGLVYWAIDLIDRI*
Ga0137413_1037756523300012924Vadose Zone SoilVLFLADIFPGGGSPVADLFAIVLAVLLFALLYWAIDLIDRI*
Ga0137413_1046897833300012924Vadose Zone SoilVLLFADIFPGGGGPLADVFAVVVALILFGLLYWAIDLIDRI*
Ga0137413_1085687233300012924Vadose Zone SoilVLLGADIFPGGGGPLADALSVVIALVLFALLYWAIDLIDRV*
Ga0137404_1070192023300012929Vadose Zone SoilLSILADIFPGGGSPAADVFAIAIAIGLFALLYWAIDLIDRI*
Ga0137407_1193103823300012930Vadose Zone SoilVLFLADIFPGGGGPVADLFAIVLAVLLFALLYWAIDLIDRI*
Ga0164242_1000265493300012942CompostVLFLADIFPGGGSPFADVFSIAIAIAMFALLYWLISLIDRI*
Ga0164242_1035530833300012942CompostVLFLADIFPGGGGPVADVFSLALAIAMFALLYWLVGLIDRI*
Ga0164242_1043259133300012942CompostVSTFAHLLSAADIFPGGGSPVADLFSIAIAIAMFSVLYWLISLIDRI*
Ga0164241_1002145953300012943SoilVLYVLADLFPGGGSPVADVFAVAIALVLFALLYWAIDLIERI*
Ga0164241_1010951823300012943SoilVLFLADIFPGGGSPVADVFAVAIALVLFALLYWAIDLIDRI*
Ga0137410_1024801943300012944Vadose Zone SoilLVLSVLADIFPGGGGPLADVFSIAIAVGLFALLYWAIDLIDRI*
Ga0164300_1002973633300012951SoilVADIFPGGGGPIADFFSIAIAVGIFALLYWAIDLIERI*
Ga0164298_1000371453300012955SoilVLSFADIFPGGGGPVADVFAIALSVGLFALVYWAIDLIDRI*
Ga0164303_1098159033300012957SoilLSLLADIFPGGGSPVADVFAIAIAVGLFALLYWAIDLIDRI*
Ga0164303_1107010733300012957SoilLADIFPGGGGPLADVFAIAIAIGIFALLYWAIDLIDRI*
Ga0164303_1121642013300012957SoilLVLFVLADIFPGGGSPVADVFAIAIAVALFALLYWAIDLIDRV*
Ga0164301_1010874533300012960SoilVLNAADIFPGGGGVPADVFAIALSILLFALVYWAIDLIDRI*
Ga0164309_1122321613300012984SoilVLSFADIFPGGGGLPADLFAVAIAVGLFALLYWAIELIDRI*
Ga0164308_1079777713300012985SoilVPSFADIFPGGGGLPADLFAVAIAVALFAILYWAIELIDRI*
Ga0164304_1161328223300012986SoilVLFFADIFAGGGGPLADVLAIAIAVALFALLYWAIDLIDRI*
Ga0164307_1002558523300012987SoilVVPFANLFPGGGSPLADVFSIVLAVILFALLYWAIDLIDRI*
Ga0164306_1019685133300012988SoilLSFLADIFPGGGSPAADVFAIAIAVGLFALLYWAIDLIDRI*
Ga0164306_1073709223300012988SoilVLLFADIFPGGGGLPADALAVVIAFVLFALLYWAIDLIERI*
Ga0157371_1000215893300013102Corn RhizosphereVFVLADIFPGGGSPLADAVAIAIAIVLFALLYFSIELIDRV*
Ga0157370_1000224333300013104Corn RhizosphereVLSVLADIFPGGGGPLADAFSIALAIGLFALLYWAIELIDRI*
Ga0157370_1056549333300013104Corn RhizosphereVPSFADIFSGGGGLPADLFAVAIAVALFALLCWAVELIDRI*
Ga0157369_1256508323300013105Corn RhizosphereVLFLADIFPGGGGPLADVLSIAIAIAMFAVLYWLISLIDRI*
Ga0157374_1004514453300013296Miscanthus RhizosphereLLADIFPGGGSPLADLFAIALAVGLFALLYWAIDLIDRI*
Ga0157378_1115963523300013297Miscanthus RhizosphereVLVWLADIFPGGGGPLADVLAVAIAVVLFALLYWAIDLIDRI*
Ga0157378_1151350613300013297Miscanthus RhizosphereGVHDRAVLSFADIFAGGGGVPADVFAIAIAVGLFALLYWAIELIDRI*
Ga0163162_1049607133300013306Switchgrass RhizosphereVLFLADIFPGGGGLAADFFAIAIAVAMFALLYWLIGLIDRI*
Ga0163162_1114039433300013306Switchgrass RhizosphereFPGGGGPLADVLAIAIAVGLFALLYWAIDLIDRI*
Ga0157372_10000923293300013307Corn RhizosphereVFVCADLFPGGGGPVADLFSIALAVILFALLYWAIELIDRI*
Ga0157375_10000109443300013308Miscanthus RhizosphereVLSVLADIFPGGGGPLADAFSIAIAVGLFALLYWAIDLIDRI*
Ga0157375_1177002833300013308Miscanthus RhizosphereVLLLADIFPGGGGPVADVFSVAIAIAMFAVLYWLVSLIDRI*
Ga0157375_1215949933300013308Miscanthus RhizosphereVLFLADIFPGGGSPFADVFSIAIAIGMFALLYWLVSLIDRI*
Ga0157375_1239468223300013308Miscanthus RhizosphereLSFLADIFPGGGSPAADVLAIAIAVGLFALLYWAIDLIDRI*
Ga0157375_1272205713300013308Miscanthus RhizosphereLSFLADIFPGGGSPAADVFAIAIAVGLIALLYWAIDLIDRI*
Ga0120127_1000112953300013503PermafrostMADIFPGGGGPLADLFSIAIAVGLFALLYWAIDLIDRI*
Ga0075324_1000008943300014263Natural And Restored WetlandsVDDRSVFAPADIFPGGGSPIADVFAIVVSVALFALVYWAIDRIDRI*
Ga0075323_106904923300014301Natural And Restored WetlandsLFPLADIFPGGGGPLADVFAIALSVGLFALVYWAIDLIDRI*
Ga0075316_112124013300014314Natural And Restored WetlandsIFAGGSAFADVFAVALSVGLFALVYLAIELIDRI*
Ga0075356_100510833300014323Natural And Restored WetlandsVLSFADIFPGGGGPLADIFAIALSVGLFALVYWAIDLIDRI*
Ga0163163_1028081633300014325Switchgrass RhizosphereVLFLADIFPGGGSPVADVFAIAVAFVLFALLFWAIDLIDRI*
Ga0157380_1335235813300014326Switchgrass RhizosphereVLSVLLANLFPGGGGPLADVFSLVLAFALFALLYAAIELIDRV*
Ga0182019_1015126823300014498FenMLSIPDPAVLADIFPGGGGPLADVFAIAIAVGLFALLYWAIDLIDRI*
Ga0182021_1023184833300014502FenVLSFADIFPGGGGLPADLLAVAIAVALFALLYWAIELIDRI*
Ga0157379_1001550913300014968Switchgrass RhizosphereVNDGLVSSFADIFPGGGGPLADLFAIALAVGLFGLLYWAIELIDRI*
Ga0157376_1032513233300014969Miscanthus RhizosphereVLFLADIFPGGGSPIADVFSIALAIAMFALLYWLIGLIDRI*
Ga0167640_10950713300015067Glacier Forefield SoilVPSFADIFPGGGGLPADLFALAIAVGLFALLYWAIELIDRI*
Ga0167632_100416513300015085Glacier Forefield SoilVLSVLADIIPGGGGPLADVFAIAIAVGIFALLYWAIDLIDRI*
Ga0167632_102505823300015085Glacier Forefield SoilMPFPADIFPGGGPLADVFAIAIAVGLFALLYWAIDLIDRV*
Ga0167634_101940033300015090Glacier Forefield SoilVLSVLADIFPGGGGPLADVFSVAIAVGLFAILYWALDLIARICAP
Ga0167638_111348323300015197Glacier Forefield SoilMLSVPDPSALADIFPGGGSPVADVLAIAIAVALFALLYWAIDLIDRI*
Ga0137403_1072674613300015264Vadose Zone SoilVLLGADIFPGGGGPLADALSVVIALVLFALLYWAIELIDRI*
Ga0132258_1099809323300015371Arabidopsis RhizosphereVLSFADVFPGGGGPIADVFAIALSVGLFALVYWAIDLIDRI*
Ga0132257_10256398633300015373Arabidopsis RhizosphereVLSFADVFPGGGGPIADVFAIALSGGVFALVYWAIDLIDRI*
Ga0163161_1010464933300017792Switchgrass RhizosphereVLSVLADIFPGGGGPLADVFSIAIAVGLFALLYWAIDLIDRV
Ga0163161_1018247333300017792Switchgrass RhizosphereVLSFGDIFPGGGGVPADLLAVAIAVGLFALLYWAIDLIERI
Ga0187776_1004620033300017966Tropical PeatlandMIVAVLVPADIFPGGGSPIADVFAIALSVGLFALVFWAIDLIDRI
Ga0187776_1033943223300017966Tropical PeatlandMIAAMLPVADLFPGGGSPVADAFAIALSVAVFALILWAIDLIDRI
Ga0190272_1253448123300018429SoilVLFLADIFPGGGGPIADAFSMILASGLFALLYWAIDLIDRI
Ga0190274_1000066173300018476SoilLSVLADIFPGGGSPAADLLSVALAVGLFGLLYWAIELIDRI
Ga0187792_154756213300019265PeatlandADLFPGGGSPIADVFAIVLAVVLFALLYWSIDLIDRI
Ga0173482_1004906133300019361SoilMLLLADIFPGGGSPLADVFAIAIALVLFALLYWAIDLIDRV
Ga0190264_10000061133300019377SoilVLLFADLFPGGGSPLADAFSIAIALALFALLYWAIDLIERV
Ga0193702_102841333300019871SoilVLFLADIFPGGGSPVADLFSIALAILMFALLYWLIGLIDRI
Ga0193707_100522343300019881SoilVLSFADIFPGGGGLPADLFALAIAVALFAFLYWAIELIDRI
Ga0193743_101547743300019889SoilVLLVLADIFPGGGSPVADVFAIALAIVLFALLYWAIDLIERI
Ga0193743_107184023300019889SoilLLSIADILPGGGSPVADLVAVVIALVLFALLYWAIDLIDRI
Ga0193731_106188023300020001SoilVLSVLADIFPGGGGPLADVFSIAIAVGLFALLYWAIDLIDRI
Ga0193726_134096533300020021SoilVLVFADIFSGGGSPVADLFSIVLGIAMFALLYWLISLIDRI
Ga0193752_104185433300020027SoilVLLGADIFPGGGSPVADVFSIVIAIALFALLYWAIDLIDRI
Ga0193753_1017448113300020034SoilADIFPGGGSPIADVFAVFVAIILFALLYWAIDLIDRI
Ga0206351_1038048713300020077Corn, Switchgrass And Miscanthus RhizosphereDIFPGGGSPVADAFAIVLALVLFALLFWAIELIDRI
Ga0210388_1011309133300021181SoilVLFLADIFPGGGSPVADLFSIVLAIAMFALLYWLISLIDRI
Ga0193706_102684523300021339SoilVLFLADIFPGGGSPLADLFAVVLAIALFALLYWAIDLIDRI
Ga0210393_1128087023300021401SoilVLSILQPAVLADVFPGGGGPLADVFAVAIAVVLFALLCWAIDLIDRI
Ga0210389_1061301733300021404SoilVLFLADIFPGGGSPVADLFSIALAIVMFALLYWLISLIDRI
Ga0210386_1164945513300021406SoilVLVFADIFPGGGSPLADAFAVVLAVILFALLYWAIDLIDRI
Ga0193695_1000023393300021418SoilVLSVLADIFPGSGGPLADVFAIAIAVGLFALLYWAIDLIDRI
Ga0210392_1012224013300021475SoilVLFLADIFPGGGGPVADVFSIAIAIAMFAVLYWLISLIDRI
Ga0210409_1000798583300021559SoilVLLAADIFPGGGGPLADAFAIAIAVALFALLYWAIDLIDRI
Ga0193742_115553133300021976SoilARLDDPTALFSIADILPGGGSPVADLVAVVIALVLFALLYWAIDLIDRI
Ga0247792_101904813300022880SoilVSHAALVLLFANLFPGGGSPVADFFSIALAVILFALLYWAIDLIDRI
Ga0247765_101396723300023268Plant LitterVLLFANLFPGGGSPVADFFSIALAVILFALLYWAIDLIDRI
Ga0179591_110450763300024347Vadose Zone SoilVLFLADIFPGGGSPVADLFAIVLAVLLFALLYWAIDLIDRI
Ga0209941_100090793300024978Wastewater BioreactorVLFLADIFPGGGSPVADVFAIAIALFLFALLFWVIDLIDRI
Ga0207420_101174423300024983Wastewater BioreactorVPFLADIFPGGGGPLADVFSIVIAIAMFAVLYWLISLIDRI
Ga0207656_1000222023300025321Corn RhizosphereVLLFANLFPGGGGPLADVFSIAIAVVLFVALYWAVELIDRI
Ga0208356_10000031593300025504Arctic Peat SoilVLVVLSDIFPGGGGPLADVFAIAIAVALFALLYWAIDLIDRI
Ga0207929_100626413300025505Arctic Peat SoilVLCLADIFPGGGGPLADVFAIAIAVALFALLYWAIDLIERI
Ga0208219_100103833300025625Arctic Peat SoilVLVFADIFPGGGSPVADVFAVAIALAVFALLYWAIDLIDRI
Ga0208589_101273033300025634Arctic Peat SoilMQSMLILADIFPGGGSPLADVFAVVLALILFALLYWAIDLIDRI
Ga0210100_1000094133300025780Natural And Restored WetlandsVFAPADIFPGGGSPIADVFAIVVSVALFALVYWAIDRIDRI
Ga0210143_105250823300025792Natural And Restored WetlandsVLVRLADIFPGGGGPLADVFSIALAVALFALLYWAIELIDRI
Ga0210143_109201713300025792Natural And Restored WetlandsHDPPVLFVFADIFPGGGSPIADVFAIALSVGLFALVYWAIDLIDRI
Ga0210143_109917523300025792Natural And Restored WetlandsMLVLADLFPGGGGPLADAFAIAIAVGLFALLYWAMDLIDRI
Ga0209584_1005516633300025878Arctic Peat SoilVIFLSDIFPGGGGPLADVFAIAIALVLFALLYWAIDLIDRV
Ga0207682_10000034513300025893Miscanthus RhizosphereVLSSADIFPGGGGPLADLVAIALAVGLFALLYWAIDLIDRI
Ga0207692_1023377913300025898Corn, Switchgrass And Miscanthus RhizosphereLFTPADIFPGGGGPLADVFAIVLAVALFALLYWAIDLIDRI
Ga0207642_1000047353300025899Miscanthus RhizosphereVLSFADIFPGGGGPLADAVAISLSVCLFGLVYWAIDLIDRI
Ga0207710_10000154353300025900Switchgrass RhizosphereVLVRLADIFPGGGGPLADVLAIAIAVALFALLYWAIDLIERI
Ga0207710_1020096433300025900Switchgrass RhizosphereVLFLADIFPGGGSPVADVFAIAIAFVLFALLFWAIDLIDRI
Ga0207710_1064101433300025900Switchgrass RhizosphereADIFPGGGGIAADAIAIAIAIAMFAVLYWLIGLIDRI
Ga0207710_1064427413300025900Switchgrass RhizosphereVLFLADIFPGGGGPLADVLAIAIAVGLFALLYWAIDLIDRI
Ga0207680_1043972833300025903Switchgrass RhizosphereVSSFAHLLSAADIFPGGGSPVADLFSIVLAIAMFALLYWLISLIDRI
Ga0207654_1001134333300025911Corn RhizosphereVFVCADLFPGGGGPLADVFSIALAVALFALLYWAIELIDRI
Ga0207654_1134883833300025911Corn RhizosphereVSSFAHLLSAADIFPGGGSPVADLFSIAIAVVMFAALYWLISLIDRI
Ga0207707_1014160333300025912Corn RhizosphereVPSFADIFSGGGGLPADLFAVAVATALFTLLCWAIELIDRI
Ga0207671_1049958823300025914Corn RhizosphereVSSFAHLLSVADIFPGGGSPVADLFSIAIAVVMFAALYWLVSLIDRI
Ga0207693_1094043823300025915Corn, Switchgrass And Miscanthus RhizosphereMLVPADIFPGGGGPVADVFAIALSVALFALIFWAIDLIDRI
Ga0207663_1089468223300025916Corn, Switchgrass And Miscanthus RhizosphereVVPFANLFPGGGSPVADVFSIVLAVILFALLYWAIDLIDRI
Ga0207660_1054129233300025917Corn RhizosphereVLLLADIFPGGGSPIADVCAIGIALVLFALLFCAIDLIDRI
Ga0207652_1000748833300025921Corn RhizosphereVLFLADIFPGGDSPIADVCAIGIALVLFALLFCAIDLIDRI
Ga0207681_1027755523300025923Switchgrass RhizosphereVFVGADIFPGGGSPIADLFSILLAVGLFALLYWAIGLIDRI
Ga0207694_100000047753300025924Corn RhizosphereVLSLADIFPGGGGPIADVFAIALSVGLFALVSWAIELIDRI
Ga0207694_1053185133300025924Corn RhizosphereVSSFAHLLSAADIFPGGGSPVADLFSIAIAVVMFAALYWLVSLIDRI
Ga0207687_1000422983300025927Miscanthus RhizosphereVPSFADIFPGSGGLPADLLALAIAVALFALLYWAIELIDRI
Ga0207687_1001294823300025927Miscanthus RhizosphereVFVCADLFPGGGSPVADVFSIALAVILFALLYWAIELIDRI
Ga0207700_1005413823300025928Corn, Switchgrass And Miscanthus RhizosphereVVPFANLFPGGGSPLADVFSIALAVILFALLYWAIDLIDRI
Ga0207700_1162844913300025928Corn, Switchgrass And Miscanthus RhizosphereVDSDLFFPADIFPGGGSPLADLFAIAVAIGLFGLLYWAIDLIDRI
Ga0207664_1005717833300025929Agricultural SoilVFVCADLFPGGGGPLADAFSIALAVILFALLYWAIDLIDRI
Ga0207664_1040045523300025929Agricultural SoilVVSVADIFPGGGGPLADVFAIAIAIGLFALLYWAIDLIDRI
Ga0207644_1122614033300025931Switchgrass RhizosphereLFLADIFPGGGSPVADVFAIAIAFVLFALLFWAIDLIDRI
Ga0207686_10000033273300025934Miscanthus RhizosphereVLLFADIFPGGGGPLADLLAVAIALVLFALLYWAIDLIERI
Ga0207686_10000815243300025934Miscanthus RhizosphereVLVCLADIFPGGGGPLADVLAIVLAVALFALLYWAIDLIDRI
Ga0207686_1008970933300025934Miscanthus RhizosphereVLVIANIFPGGGGVPADLVAVVVALVTFAVLYLAIDLIDRI
Ga0207670_1031548923300025936Switchgrass RhizosphereVVPFANLFPGGGSPVADVFSIALAVVLFALLYWAIDLIDRI
Ga0207669_100000032513300025937Miscanthus RhizosphereVLSFADIFPGGGGPLADAVAISLSVCLFGLVRWAIDLIDRI
Ga0207669_1081777313300025937Miscanthus RhizosphereVLFLADIFPGGGSPVADVFAVVLALILFALLYWAIDLIDRI
Ga0207704_1000007933300025938Miscanthus RhizosphereVFVFSDLFPGGGSPLADLFSVALAVVLFALLYWAIDLIDRI
Ga0207704_1075339233300025938Miscanthus RhizosphereVPSFADIFPGGGGLPADFLAVAIAVALFALLYWAIDLIERI
Ga0207704_1148563413300025938Miscanthus RhizosphereLSFLADIFPGGGSPAADVFAIAIAVALFALLYWAIDLIDRI
Ga0207661_1000179553300025944Corn RhizosphereVLSFADIFPGGGGLPADLLALAIAVALFALLYWAIELIDRI
Ga0207712_10000007373300025961Switchgrass RhizosphereVLSFADIFPGGGGPLADLFAIALAVGLFALLYWAIDLIDRV
Ga0207712_1030819333300025961Switchgrass RhizosphereVLSLADIFPGGGGLPADLFAVAIAVGLFALLYWAIELIDRI
Ga0207712_1040419813300025961Switchgrass RhizosphereVLSVLADIFPGGGSPVADVFAVAIAVALFALLYWAIDLIDRI
Ga0207640_10000094333300025981Corn RhizosphereVFVCADLFPGGGSPVADVFSIALAVILFALLYWAVELIDRI
Ga0207640_1002965553300025981Corn RhizosphereVNDGLVLSFADIFPGGGGPLTDLFAVALAVGFFGLLYWAIDLIDRI
Ga0207703_10000310213300026035Switchgrass RhizosphereVLSFADILPGGGGLPADLLAVAIAVALFALLYWAIELIDRI
Ga0207703_10000577253300026035Switchgrass RhizosphereVLSVLADIFPGGGGPLADVFSIAIAIGLFALLYWAIELIDRV
Ga0207703_1023900533300026035Switchgrass RhizosphereIFPGGGGPLADVLAIAIAVGLFALLYWAIDLIDRI
Ga0207639_1001061023300026041Corn RhizosphereVLSFADIFPGGGGLPADLFALAIAVALFALLYGAIELIDRI
Ga0207639_1036450733300026041Corn RhizosphereVFVCGNIFPGGGSPLADLFSIALAVILFALLYWAIDLIDRI
Ga0207678_1026695433300026067Corn RhizosphereVLSVLADIFPGGGGPLADVFSVAIAIGLFALLYWAIDLIDRV
Ga0207678_1166304523300026067Corn RhizosphereVLFLADIFPGGGGIAADAFSIAIAIAMFAVLYWLIGLIDRI
Ga0207702_1002955543300026078Corn RhizosphereVLSLADIFPGGGGPAADFLAVAIAVALFALLYGAIELIDRI
Ga0207702_1036525013300026078Corn RhizosphereVLFLADIFPGGGSPIADVFAIAIALVLFALLFWAIDLIDRI
Ga0207641_10000170103300026088Switchgrass RhizosphereVLSFADIFPGGSGVLADLFAVAIAVALFAFLYWAIDLIERI
Ga0209620_102261513300026911Forest SoilMGAQDARVLFLADIFPGGGSPIADVFSIALAIAMFALLYWLISLIDRI
Ga0209110_100371823300027002Forest SoilVLFLADIFPGGGSPIADVFSIAIAIAMFALLYWLISLIDRI
Ga0209005_104632013300027037Forest SoilVLFFADIFPGGGSPVADLFSIAIAVVMFAALYWLISLIDRI
Ga0209111_103660413300027058Forest SoilVLFLADIFPGGGGPAADVFAIAIAIVMFAILYWLISLIDRI
Ga0208525_103742023300027288SoilLFADIFPGGGGLAADLFAVAIAVALFALLYWAIDLIERI
Ga0208987_104381933300027496Forest SoilVPSFADIFPGGGGLPADLFAVAIAVVLFALLYWAIELIDRI
Ga0209114_105707433300027504Forest SoilVLLLANIFPGGGSPLADVFSIAIAIAMFALLYWLISLIDRI
Ga0209113_101643133300027517Forest SoilVLFLADIFPGGGSPLADVFSIAIAIAMFALLYWLISLIDRI
Ga0208998_102228423300027524Forest SoilVLFLADIFPGGGGPFADVFSIAIAIAMFAVLYWLVSLIDRI
Ga0208998_102356213300027524Forest SoilVPSFADIFPGGGGLPADLFAVAIAVALFALLYWAIELIDRI
Ga0209222_107208323300027559Forest SoilVLLLANIFPGGGSPIADVFSIAIAIAMFALLYWLISLIDRI
Ga0209177_1000101023300027775Agricultural SoilVLSFADIFPGGGSPVADVISIALALLMFALLYWGIDLIDRI
Ga0209726_1030494823300027815GroundwaterVLFLADIFAGGGSPLADVFAVAIALGLFALLYWAIELIDRI
Ga0209112_1007926313300027817Forest SoilGGAHDACVLFLADIFPGGGSPIADVLSIAIAVAMFAVLYWLISLIDRI
Ga0209112_1020363933300027817Forest SoilVGAHDAAVLLFADIFPGGGSPVADLLSVAIAIVMFALLYWLISLIDRI
Ga0209112_1021659033300027817Forest SoilIFPGGGGIAADAFSIAIAIAMFAVLYWLISLIDRI
Ga0209624_1002057533300027895Forest SoilVLFLADIFPGGGGLLADAFAVAIALAIFALLYWAIDLIDRV
Ga0268266_1105862923300028379Switchgrass RhizosphereVLLLADIFPGGGGPVADVFSIAIAIAMFAVLYWLISLIDRI
Ga0268266_1141290523300028379Switchgrass RhizosphereVLFVLADIFPGGGGPAADAFAIAIALALFALLYWAIDLIDRI
Ga0268264_10005373113300028381Switchgrass RhizosphereVLSFIADIFPGGGSPLADAFAIALSVGLFALVFWAIDLIDRI
Ga0137415_1025112323300028536Vadose Zone SoilVLLGADIFPGGGGPLADALSVVIALVLFALLYWAIDLIDRV
Ga0265337_1000074333300028556RhizosphereVLVFADIFPGGGGPLADVFAIAIAVALFALLYWAIDLIDRI
Ga0265326_1021717023300028558RhizosphereMLSIPDPAVLADIFPGGGGPLADVFAIAIAVGLFALLYWAIDLIDRI
Ga0265334_1026825723300028573RhizosphereLFADIFPGGGGPLADVFAIAIAVVLFALLYWAIDLIDRI
Ga0307299_1010817823300028793SoilLLADIFPGGGGPLADLFAVALAVAIFALLLWAIDLIDRI
Ga0265338_10000441423300028800RhizosphereMPLADIFPGGGGPLADLLAIAIAVGLFALLYWAIDLIDRI
Ga0307503_10000027833300028802SoilVVSFADIFPGGGGPFADVFAIALSVVLFALVYWAIDLIDRI
Ga0307503_1044802333300028802SoilSVLADIFPGGGGPLADILAIAIAVGIFALLYWAIDLIDRI
Ga0307289_1011210633300028875SoilLVLFTLADIFPGGGGPVADVFAIAIAVALFALLYWAIDLIDRI
Ga0307289_1045121113300028875SoilADIFPGGGGPLADVFAIAIAVGLFALLYWAIDLIERI
Ga0247826_1107272233300030336SoilVVSFADIFPGGGPLADVFAIALSVGLFGLVYWAIDLIDRI
Ga0074003_1350599723300031003SoilVLLFADIFPGGGGPLADVVSVVLALVLFALLFWAIDLIDRI
Ga0307498_1044360333300031170SoilVLSFADIFPGGGGPIADVFAIALSVGLFALVYWAIDLIDRI
Ga0307499_1006733813300031184SoilMVSFADVFPGGGGVPADLFAVAIAVGIFALLYWAIDLIE
Ga0307500_1000977913300031198SoilVLVPADIFPGGGGPLADVFAIAVAVALFALLYWAIDLIDRI
Ga0307497_1023280013300031226SoilVLSVLADIFPGGGGPLADAFAIALSVGLFALLYWAIDLIDRI
Ga0265342_1036171813300031712RhizosphereQSVLVFADIFPGGGGPLADVFAIAIAVALFALLYWAIDLIDRI
Ga0307476_1000214653300031715Hardwood Forest SoilVLVPADIFPGGGGPVADLFSIVLAVALLALLYWAIDLIDRI
Ga0307468_10136509033300031740Hardwood Forest SoilVISFADIFPGGGSPIADVFAIALSVGLFALVYWAIDLIDRI
Ga0311367_1131888633300031918FenMNSLADIFPGGGGVPADVFAIAIALIIFALLYWAIDLIGRI
Ga0308176_1193724013300031996SoilLADIFPGGGGPAADFLAVAIAVALFALLYGAIELIDRI
Ga0307472_10010799313300032205Hardwood Forest SoilVFVCSDIFPGGGGPLADLFSIALAVVLFALLYWAIDLID
Ga0307472_10073389423300032205Hardwood Forest SoilVLSVLADIFPGGGGPLADVFAVAIAVGIFALLYWAIDLIDRI
Ga0307472_10138506013300032205Hardwood Forest SoilVNDGLVLSFADIFPGGGGPLADLFSIALAVGLFGLLYWAIDVIDRI
Ga0335085_1036780523300032770SoilVLVPADVFPGGGGPLADVFAIALSVGLFALIFWAIDLIDRI
Ga0335078_1112543123300032805SoilLFPAANIFPGGGSPVADVFAIAIAIGIFALLYWAIDLIDRI
Ga0335070_10000184323300032829SoilVLVLDSIQTFADIFPGGGSPLADAFSIALAVALFALLLWAIDLIDRI
Ga0335070_1041855233300032829SoilVLSVLADIFPGGGSPVADVFAIALSVFLFALIYWAIDLIDRI
Ga0335070_1049787133300032829SoilMIAAVLVPADIFPGGGSPIADVFAIALSVGLFALVFWAIDLIDRI
Ga0335070_1209072023300032829SoilVLFVLADLFPGGGGPLADVVAIAIAVALFALLYWAIDLIDRI
Ga0335075_1003673813300032896SoilVLFLADIFPGGGSPVADLFSIAIAVAMFALLYWLIGLIDRI
Ga0335075_1138318933300032896SoilVLFLADIFPGGGSPVADLFSIVLAIAMFAVLYWLISLIDRI
Ga0335083_10000500393300032954SoilVLLLADIFPGGGSPVADVFSIALAIAMFALLYWLIALIDRI
Ga0335076_1153274523300032955SoilVLSPADIFPGGGGVPADVFAIALSVLLFALVYWAIDLIDRI
Ga0326726_1085014813300033433Peat SoilLADIFPGGGSPLADAFAIAISVALFALIYWAIDLIDRI
Ga0372943_0277517_51_1763300034268SoilVPSFADIFPGAGGLPADLFAVAIAVGLFALLYWAIELIDRI
Ga0370497_0000441_664_7893300034965Untreated Peat SoilLSFLADIFPGGGSPAADVFAIAIAVCLFALLYWAIDLIDRI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.