Basic Information | |
---|---|
Taxon OID | 2058419004 Open in IMG/M |
Scaffold ID | GBSWBV_contig00723 Open in IMG/M |
Source Dataset Name | Hot spring viral communities from Great Boiling Spring, Nevada - |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2009 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Desulfurococcales → Pyrodictiaceae → Pyrodictium → unclassified Pyrodictium → Pyrodictium sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Spring → Hot Spring Microbial Communities From Great Boiling Spring, Nevada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Great Boiling Spring, Nevada | |||||||
Coordinates | Lat. (o) | 40.65833 | Long. (o) | -119.37772 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F104050 | Metagenome | 101 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
GBSWBV_00205720 | F104050 | N/A | SLIHFLFKPTHLYIHLLERELSEKKCIIRLRKTCVVYSELQSSEQEKYGTKEFVVTYCSMCIKAYYAKAKMKLVNKYSVVNTL |
⦗Top⦘ |