Basic Information | |
---|---|
Taxon OID | 2058419004 Open in IMG/M |
Scaffold ID | GBSWBV_contig01352 Open in IMG/M |
Source Dataset Name | Hot spring viral communities from Great Boiling Spring, Nevada - |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1620 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Spring → Hot Spring Microbial Communities From Great Boiling Spring, Nevada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Great Boiling Spring, Nevada | |||||||
Coordinates | Lat. (o) | 40.65833 | Long. (o) | -119.37772 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F104050 | Metagenome | 101 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
GBSWBV_00405520 | F104050 | GAGG | VSEAKKCIIRLRKTCVVFESLVDEERQKYGTKEFVVTYCSMCIKTYYAKAKHKLVNKFSVVNTL |
⦗Top⦘ |