Scaffold PermFrostAlaska_NODE_16194_len_8398_cov_25_565849

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold PermFrostAlaska_NODE_16194_len_8398_cov_25_565849

Scaffold PermFrostAlaska_NODE_16194_len_8398_cov_25_565849

Overview

Basic Information
Taxon OID	2067725009 Open in IMG/M
Scaffold ID	PermFrostAlaska_NODE_16194_len_8398_cov_25_565849 Open in IMG/M
Source Dataset Name	Permafrost microbial communities from central Alaska, USA - Permafrost field sample
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8448
Total Scaffold Genes	18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	13 (72.22%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From Central Alaska, Usa

Source Dataset Sampling Location
Location Name	Alaska, USA
Coordinates	Lat. (^o)	65.7906	Long. (^o)	-149.9102	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085859	Metagenome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
draft_perm_00008360	F085859	AGTAGG	MNDEKTRERKPKEPSFVTGQEALIYEVERACGQLNKLKELQLNDPLLRAVAAEIRAHMDHLGLSLIELTEPCG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.