NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold OSPD_GOCTFRE01D9R05

Scaffold OSPD_GOCTFRE01D9R05


Overview

Basic Information
Taxon OID2084038022 Open in IMG/M
Scaffold IDOSPD_GOCTFRE01D9R05 Open in IMG/M
Source Dataset NameHot spring microbial community from Yellowstone National Park, USA - OSP
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)507
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Community From Yellowstone National Park, Us

Source Dataset Sampling Location
Location NameYellowstone National Park
CoordinatesLat. (o)44.560318Long. (o)-110.708889Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020733Metagenome / Metatranscriptome222Y

Sequences

Protein IDFamilyRBSSequence
OSPD_00345300F020733AGGMSEIVWDDEKKEYVRAEDLRERKLIQKIIAELIQALQSDYTLQIQINLQNGQGTITIVPKQQT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.