NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ASLM90b_GN81PCX02F23KJ_length_522

Scaffold ASLM90b_GN81PCX02F23KJ_length_522


Overview

Basic Information
Taxon OID2100351012 Open in IMG/M
Scaffold IDASLM90b_GN81PCX02F23KJ_length_522 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from low methane PC12-244-90cm
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)522
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment → Coastal Water And Sediment Microbial Communities From Arctic Ocean, Off The Coast From Alaska

Source Dataset Sampling Location
Location NameArctic Ocean
CoordinatesLat. (o)74.0678Long. (o)-145.54687Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010928Metagenome / Metatranscriptome297N

Sequences

Protein IDFamilyRBSSequence
ASLM90b_01203690F010928N/AMETQRFMGSGQLVDRLAAQVRDKGFAKALLKKRGDMNPDGSLTAKGEEANAMNSGQRATKRASEKSGKPEYLYTYNPLTNTSTLA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.