Scaffold ASLM90b_contig01503__length_556___numreads_6

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold ASLM90b_contig01503__length_556___numreads_6

Scaffold ASLM90b_contig01503__length_556___numreads_6

Overview

Basic Information
Taxon OID	2100351012 Open in IMG/M
Scaffold ID	ASLM90b_contig01503__length_556___numreads_6 Open in IMG/M
Source Dataset Name	Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from low methane PC12-244-90cm
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	556
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae → Fragilariopsis → Fragilariopsis cylindrus → Fragilariopsis cylindrus CCMP1102	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment → Coastal Water And Sediment Microbial Communities From Arctic Ocean, Off The Coast From Alaska

Source Dataset Sampling Location
Location Name	Arctic Ocean
Coordinates	Lat. (^o)	74.0678	Long. (^o)	-145.54687	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068121	Metagenome / Metatranscriptome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
ASLM90b_03692420	F068121	N/A	KLKPSAEDSTIWKDDDGRPWKLNAEPNAAYHQPMSVPVAFIRAYASKCIPSLKVPNLKFISPNADGRYSEVCANRYTGELVIDQKIIGTFNLATDAPDAMKDGKLPTTGEHDTLDVIPHNEYGGKYKQIAKGIEIGSLEKGPVILALLE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.