Scaffold GOZG4CW03GS1MU

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GOZG4CW03GS1MU

Scaffold GOZG4CW03GS1MU

Overview

Basic Information
Taxon OID	2140918005 Open in IMG/M
Scaffold ID	GOZG4CW03GS1MU Open in IMG/M
Source Dataset Name	Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from high methane PC12-225-485cm
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	534
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment → Coastal Water And Sediment Microbial Communities From Arctic Ocean, Off The Coast From Alaska

Source Dataset Sampling Location
Location Name	Arctic Ocean
Coordinates	Lat. (^o)	74.0678	Long. (^o)	-145.54687	Alt. (m)		Depth (m)	3
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099974	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
ASHM485C_03085880	F099974	N/A	MGAETKQIAKISYVTDTDVGYYEIGEVEGAFQEAELRDYIKRFGHEKLCTRLGYMQFQVWDALREINGERDEENSPK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.