Scaffold contig02392

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold contig02392

Scaffold contig02392

Overview

Basic Information
Taxon OID	2140918005 Open in IMG/M
Scaffold ID	contig02392 Open in IMG/M
Source Dataset Name	Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from high methane PC12-225-485cm
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	582
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment → Coastal Water And Sediment Microbial Communities From Arctic Ocean, Off The Coast From Alaska

Source Dataset Sampling Location
Location Name	Arctic Ocean
Coordinates	Lat. (^o)	74.0678	Long. (^o)	-145.54687	Alt. (m)		Depth (m)	3
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015149	Metagenome / Metatranscriptome	257	Y

Sequences

Protein ID	Family	RBS	Sequence
ASHM485C_02192090	F015149	N/A	RTRLVENYDELFGQGGNTSLDAVSQFSTKWGWYNSIYGLAQGDITRYEDITKLGVHECFMMLSFMKDKAEVEAKRIKQNFK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.