Basic Information | |
---|---|
Taxon OID | 2140918013 Open in IMG/M |
Scaffold ID | NODE_141019_length_1343_cov_10.679821 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1375 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Iowa, USA | |||||||
Coordinates | Lat. (o) | 41.827222 | Long. (o) | -93.008611 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F066930 | Metagenome | 126 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Iowa-Corn-GraphCirc_01983250 | F066930 | N/A | LILVEHDGLSGAIMDHSLSDGDSTNLCARLKERGIPYISYSGYSAVSGADPTAPLIVKPVPMHILLTALEELLPSTPRVS |
⦗Top⦘ |