NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Baltic_Sea__contig32209

Scaffold Baltic_Sea__contig32209


Overview

Basic Information
Taxon OID2149837002 Open in IMG/M
Scaffold IDBaltic_Sea__contig32209 Open in IMG/M
Source Dataset NameMarine microbial communities from the Baltic Sea
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterRoyal Institute of Technology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)834
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)59.888937Long. (o)24.847412Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067261Metagenome / Metatranscriptome126Y

Sequences

Protein IDFamilyRBSSequence
Baltic_Sea_00677670F067261N/AFLIDRFILNDIMLTFFSVPFMLTKVTALVLASIEVLSINENYKVVKGIDLWQSMKLLFSRAKEIKEDLNKIKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.