Scaffold Baltic_Sea__contig32220

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Baltic_Sea__contig32220

Scaffold Baltic_Sea__contig32220

Overview

Basic Information
Taxon OID	2149837002 Open in IMG/M
Scaffold ID	Baltic_Sea__contig32220 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Baltic Sea
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Royal Institute of Technology
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3031
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (42.86%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea

Source Dataset Sampling Location
Location Name	Baltic Sea
Coordinates	Lat. (^o)	59.888937	Long. (^o)	24.847412	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039407	Metagenome / Metatranscriptome	164	Y

Sequences

Protein ID	Family	RBS	Sequence
Baltic_Sea_00687030	F039407	N/A	MTDLRDEGTGYLAPPRQIRRSEDRRNEELSKELAPVINMSQG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.