Scaffold CHXX__Locus32v1rpkm604_63

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold CHXX__Locus32v1rpkm604_63

Scaffold CHXX__Locus32v1rpkm604_63

Overview

Basic Information
Taxon OID	2149837027 Open in IMG/M
Scaffold ID	CHXX__Locus32v1rpkm604_63 Open in IMG/M
Source Dataset Name	Marine microbial communities from Deepwater Horizon subsurface plume in Gulf of Mexico, 52-1 Below Plume
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1095
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha1_Bin1	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Subsurface Plume → Marine Microbial Communities From Deepwater Horizon Subsurface Plume In Gulf Of Mexico

Source Dataset Sampling Location
Location Name	Gulf of Mexico
Coordinates	Lat. (^o)	28.716667	Long. (^o)	-88.466667	Alt. (m)		Depth (m)	1300
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076161	Metagenome / Metatranscriptome	118	N

Sequences

Protein ID	Family	RBS	Sequence
CHXX_0034.00000020	F076161	N/A	MKSINFSSRCPKTGFRAFAEKPVAKSLLLPQFGGQKMPPQGASIPNRLTAWTVPQIAADPKEHSNLLSSPTNPDAPTGKPV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.