Basic Information | |
---|---|
Taxon OID | 2149837027 Open in IMG/M |
Scaffold ID | CHXX__Locus3405v1rpkm68_55 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Deepwater Horizon subsurface plume in Gulf of Mexico, 52-1 Below Plume |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 647 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota | (Source: Euk_MAG) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Subsurface Plume → Marine Microbial Communities From Deepwater Horizon Subsurface Plume In Gulf Of Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Gulf of Mexico | |||||||
Coordinates | Lat. (o) | 28.716667 | Long. (o) | -88.466667 | Alt. (m) | Depth (m) | 1300 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004471 | Metagenome / Metatranscriptome | 437 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
CHXX_0090.00000600 | F004471 | N/A | GALIELDDSRGSIKAVVNMNGQKLAGQAIKVSFTKIDLAGMKNDKKSKDLREAKENWRFSNNKEAKFRKMCLSRLKKLSSSITVLNIPEGKSDLVKKHIIESGYTVKSIEGSRRPDDKDKPKPSTGYTVAFVELASVEEAIAAVANLHNTWPKKFGTMKNDGYGNARGLVFALGGVKQEQLEKSKA |
⦗Top⦘ |