Scaffold 2158411729

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold 2158411729

Scaffold 2158411729

Overview

Basic Information
Taxon OID	2156126001 Open in IMG/M
Scaffold ID	2158411729 Open in IMG/M
Source Dataset Name	Compost microbial communities from Sao Paulo Zoo, Brazil - C5
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Sao Paulo, Virginia Bioinformatics Institute
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	519
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil

Source Dataset Sampling Location
Location Name	Sao Paulo Zoo, Brazil
Coordinates	Lat. (^o)	-23.651072	Long. (^o)	-46.620675	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020635	Metagenome	223	Y

Sequences

Protein ID	Family	RBS	Sequence
2157962331	F020635	N/A	MEFSLKQLSWIVIGALGIGGTGYLSMNSKIDELTTKVAVVHNQVATLTKQLDRIEEKLNNTKN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.