NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2200164293

Scaffold 2200164293


Overview

Basic Information
Taxon OID2199352008 Open in IMG/M
Scaffold ID2200164293 Open in IMG/M
Source Dataset NameThermophilic microbial communities from the Joint Bioenergy Institute, California, USA of rice/straw/compost enrichment - eDNA_2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)3494
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Grass → Composting → Bioreactor → Rice-Straw Enriched Compost → Rice-Straw Enriched Compost Microbial Community From Berkeley

Source Dataset Sampling Location
Location NameDavis, California, USA
CoordinatesLat. (o)38.5402727Long. (o)-121.7500776Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003125Metagenome / Metatranscriptome506Y

Sequences

Protein IDFamilyRBSSequence
2200491406F003125N/AMDPFRILKETWSVGDTIEVEAYRVERQVGLEYDSYRRVYLAHGHEWQIAGQIAKDDGKKYYLLECVA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.