Basic Information | |
---|---|
Taxon OID | 2199352008 Open in IMG/M |
Scaffold ID | 2200219843 Open in IMG/M |
Source Dataset Name | Thermophilic microbial communities from the Joint Bioenergy Institute, California, USA of rice/straw/compost enrichment - eDNA_2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2527 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Solid Waste → Grass → Composting → Bioreactor → Rice-Straw Enriched Compost → Rice-Straw Enriched Compost Microbial Community From Berkeley |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Davis, California, USA | |||||||
Coordinates | Lat. (o) | 38.5402727 | Long. (o) | -121.7500776 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003125 | Metagenome / Metatranscriptome | 506 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
2200585456 | F003125 | N/A | MDPFRILKQTWSVGDTIEVEAYRVERQVGLEYDSYRCVYLAHGHEWQIAGQIAKDDGKKYYLLECVA |
⦗Top⦘ |