NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold DRAFT_c48551

Scaffold DRAFT_c48551


Overview

Basic Information
Taxon OID2222084002 Open in IMG/M
Scaffold IDDRAFT_c48551 Open in IMG/M
Source Dataset NameSubtropical soil microbial communities from Bundaberg Australia-sugarcane farm
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterAustralian Genome Research Facility
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)509
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Subtropical Soil → Subtropical Soil Microbial Communities From Bundaberg Australia

Source Dataset Sampling Location
Location NameAustralia: Bundaberg, Queensland
CoordinatesLat. (o)-24.9Long. (o)152.39Alt. (m)Depth (m)0 to .03
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082012Metagenome / Metatranscriptome113Y

Sequences

Protein IDFamilyRBSSequence
DRAFT_00598290F082012GGAVDVAAATEHRAGQPRSERDAAFLARFDARMQLTKKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.