NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold PaMGMunAill_c0118007

Scaffold PaMGMunAill_c0118007


Overview

Basic Information
Taxon OID3300000060 Open in IMG/M
Scaffold IDPaMGMunAill_c0118007 Open in IMG/M
Source Dataset NamePanchlora_midgut_metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)672
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Digestive System → Midgut → Unclassified → Panchlora Sp. Gut → Panchlora Sp. Gut Microbial Communities From Gamboa, Panama

Source Dataset Sampling Location
Location NamePanama
CoordinatesLat. (o)9.116667Long. (o)-79.7Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030633Metagenome184N

Sequences

Protein IDFamilyRBSSequence
PaMGMunAill_01180072F030633N/ANSRDKYHSERGFLGMFPIMVAPLGEVCGVPRRLL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.