NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold TDF_MC_ARG02_113mDRAFT_c1004075

Scaffold TDF_MC_ARG02_113mDRAFT_c1004075


Overview

Basic Information
Taxon OID3300000131 Open in IMG/M
Scaffold IDTDF_MC_ARG02_113mDRAFT_c1004075 Open in IMG/M
Source Dataset NameMarine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 02_11.3m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1116
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location
Location NameMC site, Ushuaia Bay, Tierra del Fuego, Argentina
CoordinatesLat. (o)-54.810872Long. (o)-68.295525Alt. (m)Depth (m)11.3
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F061284Metagenome132N
F099205Metagenome103N

Sequences

Protein IDFamilyRBSSequence
TDF_MC_ARG02_113mDRAFT_10040751F099205N/AMIIDLKVRNQIAQLIVDMSVGESKPVRRPEMVPIIKEVNDTALIGHALRFVTN
TDF_MC_ARG02_113mDRAFT_10040752F061284N/AMTHDQAKKHEERAFDYLLKRYGWQIFTTPHFALIDGVAVKDNEITHVVEFKSRNESLSSMERFGTYLISNDKIMNGMEMARMMCVPFILIVCLIKDGTIIAVEIGDQFGLNDIGIEVKPTQTQRSMEGGKVIRNNAFIDIDKFHIL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.