Basic Information | |
---|---|
Taxon OID | 3300000131 Open in IMG/M |
Scaffold ID | TDF_MC_ARG02_113mDRAFT_c1012721 Open in IMG/M |
Source Dataset Name | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 02_11.3m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 625 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | MC site, Ushuaia Bay, Tierra del Fuego, Argentina | |||||||
Coordinates | Lat. (o) | -54.810872 | Long. (o) | -68.295525 | Alt. (m) | Depth (m) | 11.3 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F049942 | Metagenome / Metatranscriptome | 146 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
TDF_MC_ARG02_113mDRAFT_10127212 | F049942 | GAGG | MDIDYLNDLDRGDFDCREGYPHKEGQSNAYDIGYGARYVLEQMQSAGEIK* |
⦗Top⦘ |