NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LPjun08P41300mDRAFT_c1003319

Scaffold LPjun08P41300mDRAFT_c1003319


Overview

Basic Information
Taxon OID3300000141 Open in IMG/M
Scaffold IDLPjun08P41300mDRAFT_c1003319 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P4 1300m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)3302
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (90.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameP4, Pacific Ocean
CoordinatesLat. (o)48.65Long. (o)-126.666667Alt. (m)Depth (m)1300
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059362Metagenome / Metatranscriptome134Y
F090619Metagenome / Metatranscriptome108Y

Sequences

Protein IDFamilyRBSSequence
LPjun08P41300mDRAFT_10033195F090619GGAMISEKYIQIRTKVPINSDGTVFKEFNANEKFRRQDISIMLKLLPLIAKYKLDFLPKIVDYNENGYTYEFVDGKTLKEEIDNGILKLTQKMILEMKIAMDDIWKRFYDISIENKDDELFRGNGFLYHGDPWLGNVIWNDETKELKFIDIDSLSIAEFVPMTQLNNMFFQHLETLLTTQDNNKSTLGTWL*
LPjun08P41300mDRAFT_10033199F059362GGAGMTTKSFYMAGIIKTGEPFLVEDNVKLRKTADIEGNIGKIVRVGTMNDHESVYDIGSLISIDDVSLIIRSFRSGDLVAYDLNGTNSSVYKDIKVTKLLKKQDISVLFQND*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.