NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SS_2KS_010_SOILDRAFT_10111291

Scaffold SS_2KS_010_SOILDRAFT_10111291


Overview

Basic Information
Taxon OID3300000367 Open in IMG/M
Scaffold IDSS_2KS_010_SOILDRAFT_10111291 Open in IMG/M
Source Dataset NameAlkaline soda soil microbial communities from Kulunda Steppe, Russia - 2KS_010_SOIL
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)768
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils

Source Dataset Sampling Location
Location NameRussia: Kulunda Steppe
CoordinatesLat. (o)52.1Long. (o)79.14Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015517Metagenome / Metatranscriptome254Y

Sequences

Protein IDFamilyRBSSequence
SS_2KS_010_SOILDRAFT_101112912F015517AGGMYWRSIREADLPECLALQPACMGDSIVGREAALRAWQRLLDSPAFQASVIESEHLVAGHRIVACGLGVFVDRAFVDRELASPRPDLNSRIIASIVSGESVVLSREAIAVGNAGDGLDFVNLYGTWRDGVMDDDALAQVHSLLGTSFVENISGYRFNRVLKEAIGRPRIELARATGTYRLVAEFPERDSALAVVTPESARAAPYSYAA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.