Basic Information | |
---|---|
Taxon OID | 3300000397 Open in IMG/M |
Scaffold ID | ConS_8084CDRAFT_1007085 Open in IMG/M |
Source Dataset Name | Hot spring microbial streamer communities from Conch Spring, Yellowstone National Park, USA - C T=80-84 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 907 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Conch Spring, Yellowstone National Park, Wyoming, USA | |||||||
Coordinates | Lat. (o) | 44.5564135 | Long. (o) | -110.8321631 | Alt. (m) | Depth (m) | 2194.56 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F021443 | Metagenome / Metatranscriptome | 219 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
ConS_8084CDRAFT_10070852 | F021443 | N/A | MICLLNYKKISFVFTSSYVKCYNYDYNYYQTNGMLSFAVMDLVFKIINQQKRKSIVLKKRKPIIHLLNYIDILNFNNNCDKLAITLPLKNNYKTQLMHNLYLYRNSYRRRYYEDLYKDGLKVIEHKNSCIIRLEDDYDNTIQPKNLNLASMLMHILEK |
⦗Top⦘ |