NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ConS_8084CDRAFT_1012426

Scaffold ConS_8084CDRAFT_1012426


Overview

Basic Information
Taxon OID3300000397 Open in IMG/M
Scaffold IDConS_8084CDRAFT_1012426 Open in IMG/M
Source Dataset NameHot spring microbial streamer communities from Conch Spring, Yellowstone National Park, USA - C T=80-84
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)650
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → unclassified Pyrobaculum → Pyrobaculum sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameConch Spring, Yellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.5564135Long. (o)-110.8321631Alt. (m)Depth (m)2194.56
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013155Metagenome / Metatranscriptome274Y

Sequences

Protein IDFamilyRBSSequence
ConS_8084CDRAFT_10124261F013155AGGMELYQVIIVAIALANLAVTVWLLRLLIPIWQTLRKVVFALDNFDFDEISRKFLNNEKPLAENVIVKTSEKKEEGYREISITRVYKKPLDAKEVWEGIVRQMAEKLQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.