NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI11785J13272_1008003

Scaffold JGI11785J13272_1008003


Overview

Basic Information
Taxon OID3300001117 Open in IMG/M
Scaffold IDJGI11785J13272_1008003 Open in IMG/M
Source Dataset NameMarine microbial communities from the Deep Pacific Ocean - MP2098
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1423
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → sulfur-oxidizing symbionts → Candidatus Ruthia → Candidatus Ruthia magnifica(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameNorth Pacific Ocean
CoordinatesLat. (o)14.53Long. (o)-118.77Alt. (m)Depth (m)294
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F084730Metagenome / Metatranscriptome112Y

Sequences

Protein IDFamilyRBSSequence
JGI11785J13272_10080031F084730N/ANDLHSNCTVAILDTVEPVFAVGYFSYLNRITSGIYIYDLSDRLYGYGAPKGALIF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.