NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Microbial15j_105141

Scaffold Microbial15j_105141


Overview

Basic Information
Taxon OID3300001321 Open in IMG/M
Scaffold IDMicrobial15j_105141 Open in IMG/M
Source Dataset NameBioengineered switchgrass rhizosphere microbial community from Knoxville, Tennessee, USA - 15 Joint
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)641
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere → Bioengineered Switchgrass Rhizosphere Microbial Community From Knoxville, Tennessee, Usa

Source Dataset Sampling Location
Location NameKnoxville, Tennessee, USA
CoordinatesLat. (o)35.98Long. (o)-83.92Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000573Metagenome / Metatranscriptome1016Y

Sequences

Protein IDFamilyRBSSequence
Microbial15j_1051411F000573N/ARLVVSIGIGGAAYAIMLGIMVLSIVYDRELEPVVTFAFDTGRGIIGAIDSLVSGSHWGQVAANHLRERVNMTHVVLSIPAIIIAAIVIGIPFNYLLGGTRTALQRIAIALISVPATVGLAVGLFTFNALLPEAYAVLLRFADLVWHASWNALSSSGDWLPGARKLTNAARQGFSGHHYVIMALCSMAASFLVNALFAFVSRPAPAGIAQPRCD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.