Scaffold Microbial15j_140591

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Microbial15j_140591

Scaffold Microbial15j_140591

Overview

Basic Information
Taxon OID	3300001321 Open in IMG/M
Scaffold ID	Microbial15j_140591 Open in IMG/M
Source Dataset Name	Bioengineered switchgrass rhizosphere microbial community from Knoxville, Tennessee, USA - 15 Joint
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	511
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere → Bioengineered Switchgrass Rhizosphere Microbial Community From Knoxville, Tennessee, Usa

Source Dataset Sampling Location
Location Name	Knoxville, Tennessee, USA
Coordinates	Lat. (^o)	35.98	Long. (^o)	-83.92	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049869	Metagenome	146	N

Sequences

Protein ID	Family	RBS	Sequence
Microbial15j_1405911	F049869	N/A	SFTCQFASTTARDIPVALPVFLNHFDPDTGTLIISSPAVMKRVENVRQRPKVAILFSPVGTEPGEPKHVLLVQGLAEVDDTNLMSGWKRYFAGWARRQPSARESLARMEQVVPGYTQRALIRVRPTRFLGWPDGNFQQSPEVVEVNQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.