Basic Information | |
---|---|
Taxon OID | 3300001357 Open in IMG/M |
Scaffold ID | JGI11876J14442_10000001 Open in IMG/M |
Source Dataset Name | Combined assembly of Elkhorn Slough mat metaG (MD2A, MD6A, CD2A, CD6A) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 241034 |
Total Scaffold Genes | 421 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 55 (13.06%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | (Source: IMG-VR) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Microbial Mats → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Elkhorn Slough, Monterey Bay, California, USA | |||||||
Coordinates | Lat. (o) | 36.82188 | Long. (o) | -121.744 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F102160 | Metagenome | 102 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI11876J14442_10000001299 | F102160 | N/A | MLTMILFALMVSVFISYVAYIIFKYGIQKSISESYYVLPKKLNFLFVLFTWLFAIPAMFLGNSLLMFFAGGGIVWVGANAAMHKNPTRTIHLIAAIGGMILGGLAMIFQYHMWYMTAGVAGLLPILYLVDKKHFMFWAELAVFIAITITLGVNIF* |
⦗Top⦘ |