Scaffold Draft_100086

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Draft_100086

Scaffold Draft_100086

Overview

Basic Information
Taxon OID	3300001422 Open in IMG/M
Scaffold ID	Draft_100086 Open in IMG/M
Source Dataset Name	Oil sands microbial communities from Horse River, Alberta, Canada - outcrops
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	McGill University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	13892
Total Scaffold Genes	16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	12 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Oil-Contaminated → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location Name	Horse River, Fort McMurray, Alberta, Canada
Coordinates	Lat. (^o)	56.70268	Long. (^o)	-111.398858	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066257	Metagenome / Metatranscriptome	127	Y

Sequences

Protein ID	Family	RBS	Sequence
Draft_10008614	F066257	AGGAGG	MTYPAVDNLPEEATSTLLGVCAQLSRSRHPGLARWASSVSDALLVRLVSVTTGVRVDGNGNKPCPLKTLAAAELEGLHALLFAGAEASDDEWVVDWCTRMNGLILADFCRRELEQLAIDAQANAILAEERRLACLALQAPDLRVVSRRSAV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.