NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Draft_100643

Scaffold Draft_100643


Overview

Basic Information
Taxon OID3300001422 Open in IMG/M
Scaffold IDDraft_100643 Open in IMG/M
Source Dataset NameOil sands microbial communities from Horse River, Alberta, Canada - outcrops
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMcGill University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5218
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Oil-Contaminated → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location NameHorse River, Fort McMurray, Alberta, Canada
CoordinatesLat. (o)56.70268Long. (o)-111.398858Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044211Metagenome / Metatranscriptome155Y

Sequences

Protein IDFamilyRBSSequence
Draft_1006432F044211GGAMTHLSDGTVATDIDAHGDNAALSAHGYTIRHIETYHRDTDMSCIVWDAPAITEADLPF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.