Basic Information | |
---|---|
Taxon OID | 3300001422 Open in IMG/M |
Scaffold ID | Draft_100643 Open in IMG/M |
Source Dataset Name | Oil sands microbial communities from Horse River, Alberta, Canada - outcrops |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | McGill University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5218 |
Total Scaffold Genes | 8 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (87.50%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Sand → Oil-Contaminated → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Horse River, Fort McMurray, Alberta, Canada | |||||||
Coordinates | Lat. (o) | 56.70268 | Long. (o) | -111.398858 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F044211 | Metagenome / Metatranscriptome | 155 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Draft_1006432 | F044211 | GGA | MTHLSDGTVATDIDAHGDNAALSAHGYTIRHIETYHRDTDMSCIVWDAPAITEADLPF* |
⦗Top⦘ |