Scaffold WOR52_10037850

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold WOR52_10037850

Scaffold WOR52_10037850

Overview

Basic Information
Taxon OID	3300001782 Open in IMG/M
Scaffold ID	WOR52_10037850 Open in IMG/M
Source Dataset Name	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR_deep_samples
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8815
Total Scaffold Genes	16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	14 (87.50%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina

Source Dataset Sampling Location
Location Name	White Oak River estuary, North Carolina, USA
Coordinates	Lat. (^o)	34.6478111	Long. (^o)	-77.1112083	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104373	Metagenome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
WOR52_1003785013	F104373	AGGGGG	LKSWHLNRRVDDLSEKMKPVSSDVIRLDFDSFSEPEKQLFRKIWEIQEKYGSSPPADVIEANAELVFKAREIIGRRVTELFMFVMKELLGGDEVEEWYFKLHFYNFFEDLKECLANVRKWSEKDREEFLRDMKRDGMINKVFRIPRGFNARNAVKSKKRQKRKDDDRA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.