NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24123J20310_1000188

Scaffold JGI24123J20310_1000188


Overview

Basic Information
Taxon OID3300001813 Open in IMG/M
Scaffold IDJGI24123J20310_1000188 Open in IMG/M
Source Dataset NameSerpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_5A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)47029
Total Scaffold Genes53 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)43 (81.13%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid → Serpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy)

Source Dataset Sampling Location
Location NameUSA: California, McLaughlin Reserve
CoordinatesLat. (o)38.8739528Long. (o)-122.4391613Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025775Metagenome200Y

Sequences

Protein IDFamilyRBSSequence
JGI24123J20310_100018825F025775GGAGMKQLFTFQGFPMVVVTAMIIWAWISVLSVLIASFF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.