Metagenome Family F025775

Basic Information
Family ID	F025775
Family Type	Metagenome
Number of Sequences	200
Average Sequence Length	37 residues
Representative Sequence	MKQLLTFQGFPMVVVVGLIVWSWISILSVLIASFF
Number of Associated Samples	116
Number of Associated Scaffolds	200

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	84.00 %
% of genes near scaffold ends (potentially truncated)	15.00 %
% of genes from short scaffolds (< 2000 bps)	62.50 %
Associated GOLD sequencing projects	94
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.58

Most Common Taxonomy
Group	Bacteria (96.000 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment (30.500 % of family members)
Environment Ontology (ENVO)	Unclassified (34.500 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Sediment (non-saline) (34.000 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 200 Family Scaffolds
PF04545	Sigma70_r4	34.00
PF03597	FixS	25.00
PF05751	FixH	11.50
PF13746	Fer4_18	4.50
PF02687	FtsX	2.50
PF00873	ACR_tran	2.00
PF00005	ABC_tran	2.00
PF14715	FixP_N	1.50
PF00448	SRP54	1.50
PF02433	FixO	1.00
PF13084	DUF3943	1.00
PF00115	COX1	1.00
PF02881	SRP54_N	1.00
PF00550	PP-binding	0.50
PF14572	Pribosyl_synth	0.50
PF00023	Ank	0.50
PF13115	YtkA	0.50
PF14693	Ribosomal_TL5_C	0.50
PF13286	HD_assoc	0.50
PF00486	Trans_reg_C	0.50
PF05545	FixQ	0.50
PF06831	H2TH	0.50
PF02566	OsmC	0.50
PF14559	TPR_19	0.50
PF01887	SAM_HAT_N	0.50
PF01467	CTP_transf_like	0.50
PF03916	NrfD	0.50
PF13692	Glyco_trans_1_4	0.50
PF13751	DDE_Tnp_1_6	0.50
PF03602	Cons_hypoth95	0.50
PF13404	HTH_AsnC-type	0.50
PF13492	GAF_3	0.50
PF11614	FixG_C	0.50

COG ID	Name	Functional Category	% Frequency in 200 Family Scaffolds
COG3197	Cytochrome oxidase maturation protein, CcoS/FixS family	Posttranslational modification, protein turnover, chaperones [O]	25.00
COG5456	Nitrogen fixation protein FixH	Inorganic ion transport and metabolism [P]	11.50
COG2993	Cbb3-type cytochrome oxidase, cytochrome c subunit FixO	Energy production and conversion [C]	1.00
COG0266	Formamidopyrimidine-DNA glycosylase	Replication, recombination and repair [L]	0.50
COG0742	16S rRNA G966 N2-methylase RsmD	Translation, ribosomal structure and biogenesis [J]	0.50
COG1092	23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI	Translation, ribosomal structure and biogenesis [J]	0.50
COG1764	Organic hydroperoxide reductase OsmC/OhrA	Defense mechanisms [V]	0.50
COG1765	Uncharacterized OsmC-related protein	General function prediction only [R]	0.50
COG1912	Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming)	Defense mechanisms [V]	0.50
COG2242	Precorrin-6B methylase 2	Coenzyme transport and metabolism [H]	0.50
COG2265	tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family	Translation, ribosomal structure and biogenesis [J]	0.50
COG2890	Methylase of polypeptide chain release factors	Translation, ribosomal structure and biogenesis [J]	0.50
COG4736	Cbb3-type cytochrome oxidase, subunit 3	Energy production and conversion [C]	0.50

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	96.00 %
Unclassified	root	N/A	4.00 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	96.00 %
Unclassified	root	N/A	4.00 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	96.00 %
Unclassified	root	N/A	4.00 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	94.50 %
Unclassified	root	N/A	4.00 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	90.50 %
Unclassified	root	N/A	4.00 %

Name	Rank	Taxonomy	Distribution
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	88.50 %
Unclassified	root	N/A	4.00 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.50 %

Name	Rank	Taxonomy	Distribution
Thiobacillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae	88.00 %
Unclassified	root	N/A	4.00 %
Azonexaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae	0.50 %

Name	Rank	Taxonomy	Distribution
Thiobacillus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	88.00 %
Unclassified	root	N/A	4.00 %
Dechloromonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas	0.50 %

Name	Rank	Taxonomy	Distribution
Thiobacillus denitrificans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	37.50 %
Thiobacillus thioparus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	15.00 %
Unclassified	root	N/A	4.00 %
Thiobacillus thiophilus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thiophilus	2.00 %
Dechloromonas aromatica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica	0.50 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2044078019\|MiccSRB_F31IBB102F8RSO	Not Available	537	Open in IMG/M
3300000124\|BS_KBA_SWE12_21mDRAFT_c10010503	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	3013	Open in IMG/M
3300000185\|Draft_c100124	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	7717	Open in IMG/M
3300000228\|TB_PC08_66DRAFT_10003630	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	7837	Open in IMG/M
3300000228\|TB_PC08_66DRAFT_10014278	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	3639	Open in IMG/M
3300000228\|TB_PC08_66DRAFT_10124047	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	727	Open in IMG/M
3300000228\|TB_PC08_66DRAFT_10153196	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	614	Open in IMG/M
3300000228\|TB_PC08_66DRAFT_10153542	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	613	Open in IMG/M
3300000231\|TB_LI09_4DRAFT_10136385	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	844	Open in IMG/M
3300000311\|WSSedA1Ba3DRAFT_1108179	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	532	Open in IMG/M
3300000558\|Draft_10123248	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	3731	Open in IMG/M
3300000558\|Draft_10367954	All Organisms → cellular organisms → Bacteria → Proteobacteria	757	Open in IMG/M
3300000558\|Draft_10375337	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	2934	Open in IMG/M
3300000558\|Draft_11688405	Not Available	646	Open in IMG/M
3300001592\|Draft_10212875	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	749	Open in IMG/M
3300001592\|Draft_10360169	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	525	Open in IMG/M
3300001605\|Draft_10002874	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	21086	Open in IMG/M
3300001605\|Draft_10023387	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	5775	Open in IMG/M
3300001813\|JGI24123J20310_1000188	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	47029	Open in IMG/M
3300003408\|JGI26524J50256_1003382	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → Dechloromonas aromatica	7692	Open in IMG/M
3300003418\|JGI26523J50269_1076542	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	509	Open in IMG/M
3300004066\|Ga0055484_10225592	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	518	Open in IMG/M
3300004072\|Ga0055512_10117843	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	557	Open in IMG/M
3300004282\|Ga0066599_100145465	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	1209	Open in IMG/M
3300005643\|Ga0079369_1014793	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	4235	Open in IMG/M
3300005643\|Ga0079369_1015908	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	4128	Open in IMG/M
3300005643\|Ga0079369_1027440	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	3344	Open in IMG/M
3300005643\|Ga0079369_1035643	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	2984	Open in IMG/M
3300005643\|Ga0079369_1063271	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	2258	Open in IMG/M
3300005643\|Ga0079369_1112496	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	1608	Open in IMG/M
3300005643\|Ga0079369_1267366	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	631	Open in IMG/M
3300005794\|Ga0079490_100087	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	4282	Open in IMG/M
3300005892\|Ga0075275_1011198	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	1216	Open in IMG/M
3300006224\|Ga0079037_100011513	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	5798	Open in IMG/M
3300006224\|Ga0079037_100041774	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	3506	Open in IMG/M
3300006224\|Ga0079037_100066259	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	2901	Open in IMG/M
3300006224\|Ga0079037_100515050	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	1150	Open in IMG/M
3300006224\|Ga0079037_101091413	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	792	Open in IMG/M
3300006417\|Ga0069787_10436200	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	4658	Open in IMG/M
3300006417\|Ga0069787_11444188	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	1068	Open in IMG/M
3300007281\|Ga0104349_1087169	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	1483	Open in IMG/M
3300009009\|Ga0105105_10016958	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	3008	Open in IMG/M
3300009009\|Ga0105105_10090683	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	1459	Open in IMG/M
3300009009\|Ga0105105_10382785	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	780	Open in IMG/M
3300009037\|Ga0105093_10014655	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	3229	Open in IMG/M
3300009037\|Ga0105093_10846198	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	534	Open in IMG/M
3300009053\|Ga0105095_10106108	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	1525	Open in IMG/M
3300009053\|Ga0105095_10252730	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	967	Open in IMG/M
3300009053\|Ga0105095_10303413	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	878	Open in IMG/M
3300009053\|Ga0105095_10320492	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	853	Open in IMG/M
3300009053\|Ga0105095_10337710	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	829	Open in IMG/M
3300009053\|Ga0105095_10719913	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	557	Open in IMG/M
3300009053\|Ga0105095_10809254	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	525	Open in IMG/M
3300009070\|Ga0066256_1000626	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	78548	Open in IMG/M
3300009075\|Ga0105090_10034449	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	3155	Open in IMG/M
3300009075\|Ga0105090_10040748	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	2902	Open in IMG/M
3300009075\|Ga0105090_10416393	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	819	Open in IMG/M
3300009075\|Ga0105090_10953812	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	523	Open in IMG/M
3300009078\|Ga0105106_10706677	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	720	Open in IMG/M
3300009078\|Ga0105106_10749759	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	696	Open in IMG/M
3300009078\|Ga0105106_11307644	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	514	Open in IMG/M
3300009081\|Ga0105098_10337286	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	733	Open in IMG/M
3300009081\|Ga0105098_10686322	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	542	Open in IMG/M
3300009082\|Ga0105099_10450783	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	774	Open in IMG/M
3300009082\|Ga0105099_10659429	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	646	Open in IMG/M
3300009082\|Ga0105099_11008017	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	530	Open in IMG/M
3300009085\|Ga0105103_10529615	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	664	Open in IMG/M
3300009087\|Ga0105107_10139469	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	1706	Open in IMG/M
3300009087\|Ga0105107_10221658	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	1323	Open in IMG/M
3300009087\|Ga0105107_10234289	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	1283	Open in IMG/M
3300009087\|Ga0105107_10400616	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	957	Open in IMG/M
3300009087\|Ga0105107_10595658	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	770	Open in IMG/M
3300009111\|Ga0115026_10728477	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	768	Open in IMG/M
3300009131\|Ga0115027_10246899	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	1169	Open in IMG/M
3300009146\|Ga0105091_10007165	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	4719	Open in IMG/M
3300009153\|Ga0105094_10269807	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	978	Open in IMG/M
3300009153\|Ga0105094_10630767	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	626	Open in IMG/M
3300009153\|Ga0105094_10657010	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	613	Open in IMG/M
3300009153\|Ga0105094_10816433	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	549	Open in IMG/M
3300009153\|Ga0105094_10902350	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	522	Open in IMG/M
3300009166\|Ga0105100_10008861	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	5833	Open in IMG/M
3300009166\|Ga0105100_10012016	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	5012	Open in IMG/M
3300009166\|Ga0105100_10660222	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	643	Open in IMG/M
3300009166\|Ga0105100_11030646	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	517	Open in IMG/M
3300009169\|Ga0105097_10674904	Not Available	584	Open in IMG/M
3300009169\|Ga0105097_10737212	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	559	Open in IMG/M
3300009170\|Ga0105096_10268669	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	868	Open in IMG/M
3300009171\|Ga0105101_10535807	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	577	Open in IMG/M
3300009179\|Ga0115028_11372761	Not Available	592	Open in IMG/M
3300009416\|Ga0124846_1001743	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	7340	Open in IMG/M
3300009416\|Ga0124846_1207735	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	806	Open in IMG/M
3300009506\|Ga0118657_10004973	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	21741	Open in IMG/M
3300009506\|Ga0118657_10029428	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	11321	Open in IMG/M
3300009693\|Ga0116141_10111013	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	1623	Open in IMG/M
3300009695\|Ga0123337_10013318	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	6956	Open in IMG/M
3300010356\|Ga0116237_10277159	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	1535	Open in IMG/M
3300011007\|Ga0139299_1164989	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	2175	Open in IMG/M
3300011264\|Ga0151623_1065299	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	12199	Open in IMG/M
3300011340\|Ga0151652_10551474	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	584	Open in IMG/M
3300012668\|Ga0157216_10034353	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	2580	Open in IMG/M
3300012981\|Ga0168316_102893	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	4366	Open in IMG/M
3300013092\|Ga0163199_1000066	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	66125	Open in IMG/M
3300014205\|Ga0172380_10331434	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	1153	Open in IMG/M
3300014205\|Ga0172380_11314244	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	504	Open in IMG/M
3300014270\|Ga0075325_1079717	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	743	Open in IMG/M
3300014300\|Ga0075321_1047227	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	755	Open in IMG/M
3300014322\|Ga0075355_1017683	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	1417	Open in IMG/M
3300014323\|Ga0075356_1078129	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	764	Open in IMG/M
3300014323\|Ga0075356_1175134	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	565	Open in IMG/M
3300014814\|Ga0119849_1014733	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1828	Open in IMG/M
3300014830\|Ga0119906_1145724	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	680	Open in IMG/M
3300015208\|Ga0167664_1025924	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	2035	Open in IMG/M
3300015370\|Ga0180009_10045803	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	2822	Open in IMG/M
3300015370\|Ga0180009_10093763	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	1605	Open in IMG/M
3300015370\|Ga0180009_10439305	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	511	Open in IMG/M
3300018055\|Ga0184616_10026536	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	1816	Open in IMG/M
3300019775\|Ga0197853_1011526	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	104739	Open in IMG/M
3300019775\|Ga0197853_1014544	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	164985	Open in IMG/M
3300019775\|Ga0197853_1021850	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	8360	Open in IMG/M
3300019775\|Ga0197853_1043694	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	120258	Open in IMG/M
3300022181\|Ga0228535_1000633	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	87537	Open in IMG/M
3300022553\|Ga0212124_10000038	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	112289	Open in IMG/M
3300024056\|Ga0124853_1139821	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	715	Open in IMG/M
3300024973\|Ga0209959_100011	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	659158	Open in IMG/M
3300024973\|Ga0209959_100036	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	329946	Open in IMG/M
3300024973\|Ga0209959_100058	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	259641	Open in IMG/M
3300024978\|Ga0209941_1047645	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	972	Open in IMG/M
3300024988\|Ga0209958_1002413	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	10545	Open in IMG/M
3300025000\|Ga0209318_1002642	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	8519	Open in IMG/M
3300025153\|Ga0209512_1099818	All Organisms → cellular organisms → Bacteria → Proteobacteria	1293	Open in IMG/M
3300025525\|Ga0208244_100153	Not Available	86916	Open in IMG/M
3300025525\|Ga0208244_100301	All Organisms → cellular organisms → Bacteria	54810	Open in IMG/M
3300025525\|Ga0208244_105096	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	3312	Open in IMG/M
3300025856\|Ga0209604_1194594	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	811	Open in IMG/M
3300025963\|Ga0210146_1002165	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	1833	Open in IMG/M
3300026019\|Ga0208528_1017182	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	682	Open in IMG/M
3300026349\|Ga0256811_1008044	Not Available	939	Open in IMG/M
3300026463\|Ga0256815_1015255	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	804	Open in IMG/M
3300027282\|Ga0209346_1024916	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	986	Open in IMG/M
3300027283\|Ga0209643_1000039	All Organisms → cellular organisms → Bacteria	381070	Open in IMG/M
3300027675\|Ga0209077_1001555	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	6289	Open in IMG/M
3300027675\|Ga0209077_1003410	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	4201	Open in IMG/M
3300027713\|Ga0209286_1022253	All Organisms → cellular organisms → Bacteria → Proteobacteria	2331	Open in IMG/M
3300027713\|Ga0209286_1041437	All Organisms → cellular organisms → Bacteria → Proteobacteria	1722	Open in IMG/M
3300027713\|Ga0209286_1233369	Not Available	655	Open in IMG/M
3300027721\|Ga0209492_1106461	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	986	Open in IMG/M
3300027723\|Ga0209703_1043879	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	1741	Open in IMG/M
3300027723\|Ga0209703_1166156	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	824	Open in IMG/M
3300027726\|Ga0209285_10099012	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thiophilus	888	Open in IMG/M
3300027726\|Ga0209285_10232542	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	578	Open in IMG/M
3300027739\|Ga0209575_10116404	All Organisms → cellular organisms → Bacteria → Proteobacteria	970	Open in IMG/M
3300027740\|Ga0214474_1025035	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	2331	Open in IMG/M
3300027792\|Ga0209287_10194766	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	772	Open in IMG/M
3300027818\|Ga0209706_10005575	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	6611	Open in IMG/M
3300027818\|Ga0209706_10130137	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	1244	Open in IMG/M
3300027818\|Ga0209706_10191480	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	995	Open in IMG/M
3300027818\|Ga0209706_10479043	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	571	Open in IMG/M
3300027841\|Ga0209262_10166336	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	1061	Open in IMG/M
3300027871\|Ga0209397_10023803	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	1970	Open in IMG/M
3300027871\|Ga0209397_10180989	All Organisms → cellular organisms → Bacteria → Proteobacteria	958	Open in IMG/M
3300027871\|Ga0209397_10200658	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	917	Open in IMG/M
3300027877\|Ga0209293_10452455	All Organisms → cellular organisms → Bacteria → Proteobacteria	670	Open in IMG/M
3300027885\|Ga0209450_10794839	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	683	Open in IMG/M
3300027887\|Ga0208980_10003569	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	9433	Open in IMG/M
3300027887\|Ga0208980_10287468	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	954	Open in IMG/M
3300027890\|Ga0209496_10722570	Not Available	546	Open in IMG/M
3300027955\|Ga0209078_1077936	All Organisms → cellular organisms → Bacteria	963	Open in IMG/M
3300027972\|Ga0209079_10251233	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thiophilus	602	Open in IMG/M
3300028735\|Ga0272446_1000842	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	46809	Open in IMG/M
3300029892\|Ga0246235_101953	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	5207	Open in IMG/M
3300030613\|Ga0299915_10039230	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	3534	Open in IMG/M
3300031578\|Ga0307376_10000010	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thiophilus	382613	Open in IMG/M
3300032018\|Ga0315272_10020734	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	2985	Open in IMG/M
3300032018\|Ga0315272_10145692	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	1112	Open in IMG/M
3300032018\|Ga0315272_10717813	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	509	Open in IMG/M
3300032173\|Ga0315268_10001853	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	24309	Open in IMG/M
3300032256\|Ga0315271_10000448	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	22494	Open in IMG/M
3300032256\|Ga0315271_10639432	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	911	Open in IMG/M
3300033413\|Ga0316603_10967265	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	803	Open in IMG/M
3300033414\|Ga0316619_10011490	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	3708	Open in IMG/M
3300033418\|Ga0316625_100030241	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	2348	Open in IMG/M
3300033433\|Ga0326726_10019273	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	5932	Open in IMG/M
3300033480\|Ga0316620_10007953	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	5507	Open in IMG/M
3300033480\|Ga0316620_11285508	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	719	Open in IMG/M
3300033482\|Ga0316627_100020321	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus	3449	Open in IMG/M
3300033482\|Ga0316627_100024367	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	3240	Open in IMG/M
3300033485\|Ga0316626_10359722	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thiophilus	1204	Open in IMG/M
3300033485\|Ga0316626_11831525	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	549	Open in IMG/M
3300033487\|Ga0316630_10101499	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	1928	Open in IMG/M
3300033489\|Ga0299912_10004650	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	11254	Open in IMG/M
3300033513\|Ga0316628_100134125	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	2863	Open in IMG/M
3300033513\|Ga0316628_101584634	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	872	Open in IMG/M
3300033513\|Ga0316628_102711869	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	652	Open in IMG/M
3300033513\|Ga0316628_102804244	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	640	Open in IMG/M
3300033521\|Ga0316616_102001424	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	767	Open in IMG/M
3300033521\|Ga0316616_102143112	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	743	Open in IMG/M
3300033521\|Ga0316616_102467560	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	697	Open in IMG/M
3300034052\|Ga0373889_007903	All Organisms → cellular organisms → Bacteria → Proteobacteria	1423	Open in IMG/M
3300034056\|Ga0373893_016983	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	870	Open in IMG/M
3300034169\|Ga0370480_0162832	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus	761	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	78.50%
Engineered	Engineered	21.50%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	58.50%
Terrestrial	Environmental → Terrestrial	20.00%
Bioremediation	Engineered → Bioremediation	9.50%
Wastewater	Engineered → Wastewater	8.00%
Lab Enrichment	Engineered → Lab Enrichment	2.00%
Solid Waste	Engineered → Solid Waste	1.00%
Bioreactor	Engineered → Bioreactor	0.50%
Modeled	Engineered → Modeled	0.50%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	53.00%
Soil	Environmental → Terrestrial → Soil	15.50%
Hydrocarbon	Engineered → Bioremediation → Hydrocarbon	8.50%
Marine	Environmental → Aquatic → Marine	4.50%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	4.50%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	3.50%
Defined Media	Engineered → Lab Enrichment → Defined Media	2.00%
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	1.50%
Nutrient Removal	Engineered → Wastewater → Nutrient Removal	1.50%
Landfill	Engineered → Solid Waste → Landfill	1.00%
Metal	Engineered → Bioremediation → Metal	1.00%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.50%
Sediment	Environmental → Aquatic → Sediment	0.50%
Peat	Environmental → Terrestrial → Peat	0.50%
Geologic	Environmental → Terrestrial → Geologic	0.50%
Activated Sludge	Engineered → Wastewater → Activated Sludge	0.50%
Unclassified	Engineered → Bioreactor → Unclassified	0.50%
Simulated Communities (Microbial Mixture)	Engineered → Modeled → Simulated Communities (Microbial Mixture)	0.50%

Habitat	Taxonomy	Distribution
Sediment	Environmental → Aquatic → Freshwater → Sediment	35.00%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	12.50%
Unclassified	Engineered → Bioremediation → Hydrocarbon → Unclassified	8.50%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	5.50%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	4.50%
Wetlands	Environmental → Aquatic → Marine → Wetlands	4.50%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	4.50%
Lake	Environmental → Aquatic → Freshwater → Lake	4.00%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	2.50%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	2.00%
Anaerobic Media	Engineered → Lab Enrichment → Defined Media → Anaerobic Media	2.00%
Ice	Environmental → Aquatic → Freshwater → Ice	1.50%
Pond	Environmental → Aquatic → Freshwater → Pond	1.50%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	1.50%
Biological Phosphorus Removal	Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal	1.50%
Clay	Environmental → Terrestrial → Deep Subsurface → Clay	1.00%
Unclassified	Engineered → Solid Waste → Landfill → Unclassified	1.00%
Unclassified	Engineered → Bioremediation → Metal → Unclassified	1.00%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.50%
Storm Water	Environmental → Aquatic → Freshwater → Storm Water	0.50%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.50%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.50%
Clay	Environmental → Terrestrial → Soil → Clay	0.50%
Fracking Water	Environmental → Terrestrial → Deep Subsurface → Fracking Water	0.50%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.50%
Mine	Environmental → Terrestrial → Geologic → Mine	0.50%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	0.50%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified	0.50%
Unclassified	Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified	0.50%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	35.00%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	12.50%
Unclassified	Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified	8.50%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	4.50%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	3.00%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	3.00%
Cave Water	Environmental → Aquatic → Freshwater → Groundwater → Cave Water	3.00%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	3.00%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	2.00%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	2.00%
Unclassified	Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified	2.00%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	1.50%
Glacier	Environmental → Aquatic → Freshwater → Ice → Glacier	1.50%
Sediment	Environmental → Aquatic → Freshwater → Pond → Sediment	1.50%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.50%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	1.50%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	1.50%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	1.00%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	1.00%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Clay → Unclassified	1.00%
Unclassified	Engineered → Solid Waste → Landfill → Unclassified → Unclassified	1.00%
Activated Sludge	Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Activated Sludge	1.00%
Unclassified	Engineered → Bioremediation → Metal → Unclassified → Unclassified	1.00%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.50%
Acid Mine Drainage	Environmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage	0.50%
Drainage Pipe Biofilm	Environmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm	0.50%
Sediment	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment	0.50%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.50%
Unclassified	Environmental → Terrestrial → Soil → Clay → Unclassified	0.50%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified	0.50%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.50%
Unclassified	Environmental → Terrestrial → Geologic → Mine → Unclassified	0.50%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	0.50%
Bioreactor	Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor	0.50%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified	0.50%
Unclassified	Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified	0.50%

Habitat	Taxonomy	Distribution
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	30.50%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	8.50%
Wastewater Bioreactor	Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor	8.50%
Hydrocarbon Resource Environments	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments	4.50%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	4.00%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	3.00%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	3.00%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater	3.00%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	2.50%
Serpentinite Rock And Fluid	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid	2.00%
Enriched Sediment	Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enriched Sediment	2.00%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater	1.50%
Freshwater	Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater	1.50%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.50%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	1.50%
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	1.50%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	1.00%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment	1.00%
Glacier Valley	Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley	1.00%
Mangrove Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment	1.00%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	1.00%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	1.00%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	1.00%
Landfill Leachate	Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate	1.00%
Enhanced Biological Phosphorus Removal Bioreactor	Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Activated Sludge → Enhanced Biological Phosphorus Removal Bioreactor	1.00%
Sediment Slurry	Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry	1.00%
Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment	0.50%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.50%
Wetland	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland	0.50%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.50%
Sediment	Environmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Sediment	0.50%
Basal Ice	Environmental → Aquatic → Freshwater → Ice → Glacier → Basal Ice	0.50%
Concrete Drainage Pipe Biofilm	Environmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm	0.50%
Marine	Environmental → Aquatic → Marine → Wetlands → Sediment → Marine	0.50%
Microbial Mat	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Microbial Mat	0.50%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.50%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.50%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.50%
Soil	Environmental → Terrestrial → Soil → Clay → Unclassified → Soil	0.50%
Fracture Fluid	Environmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified → Fracture Fluid	0.50%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Subsurface	0.50%
Deep Surbsurface	Environmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Surbsurface	0.50%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.50%
Weathered Mine Tailings	Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings	0.50%
Aeration Tank Of Activated Sludge Process	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Aeration Tank Of Activated Sludge Process	0.50%
Activated Sludge	Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge	0.50%
Wastewater Bioreactor	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Wastewater Bioreactor	0.50%
Defined Medium	Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium	0.50%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2044078019	Concrete drainage pipe biofilm microbial communities from Ohio, US, sample, 12383	Environmental	Open in IMG/M
3300000124	Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m	Environmental	Open in IMG/M
3300000185	Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011	Engineered	Open in IMG/M
3300000228	Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- PC08_66	Environmental	Open in IMG/M
3300000231	Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_4	Environmental	Open in IMG/M
3300000311	Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk	Environmental	Open in IMG/M
3300000558	Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011	Engineered	Open in IMG/M
3300001592	Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes in water sample from Medicine Hat oil field -PW_MHGC_2012April2:	Engineered	Open in IMG/M
3300001605	Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin	Engineered	Open in IMG/M
3300001813	Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_5A	Environmental	Open in IMG/M
3300003408	Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_inoc_plan	Engineered	Open in IMG/M
3300003418	Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_inoc_biof	Engineered	Open in IMG/M
3300004066	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D2	Environmental	Open in IMG/M
3300004072	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D2	Environmental	Open in IMG/M
3300004282	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment	Environmental	Open in IMG/M
3300005643	Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_750_biof (version 3)	Engineered	Open in IMG/M
3300005794	Subglacial sediment microbial community from Lake Whillans, Antarctica - at 0-2 cm depth	Environmental	Open in IMG/M
3300005892	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_305	Environmental	Open in IMG/M
3300006224	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG	Environmental	Open in IMG/M
3300006417	Combined Assembly of Gp0110018, Gp0110022, Gp0110020	Engineered	Open in IMG/M
3300007281	Activated sludge microbial communities from bioreactor with dissolved oxygen in CSIR-NEERI, Nagpur, India ? 2ppm of oxygen, sample B	Engineered	Open in IMG/M
3300009009	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015	Environmental	Open in IMG/M
3300009037	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015	Environmental	Open in IMG/M
3300009053	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009070	Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_1000_biof (version 2)	Engineered	Open in IMG/M
3300009075	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015	Environmental	Open in IMG/M
3300009078	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009081	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009082	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015	Environmental	Open in IMG/M
3300009085	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009087	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009111	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1	Environmental	Open in IMG/M
3300009131	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1	Environmental	Open in IMG/M
3300009146	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015	Environmental	Open in IMG/M
3300009153	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015	Environmental	Open in IMG/M
3300009166	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015	Environmental	Open in IMG/M
3300009169	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015	Environmental	Open in IMG/M
3300009170	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015	Environmental	Open in IMG/M
3300009171	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009179	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1	Environmental	Open in IMG/M
3300009416	Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_1000_biof (PacBio error correction)	Engineered	Open in IMG/M
3300009506	Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8	Environmental	Open in IMG/M
3300009693	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG	Engineered	Open in IMG/M
3300009695	Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - frozenSSSS metaG	Environmental	Open in IMG/M
3300010356	AD_USDEca	Engineered	Open in IMG/M
3300011007	Basal ice microbial communities from Matanuska glacier, Alaska, USA - MataB	Environmental	Open in IMG/M
3300011264	Acid mine drainage microbial communities from Malanjkhand copper mine, India - M16 k-mer 63	Environmental	Open in IMG/M
3300011340	Combined Assembly of Wetland Metatranscriptomes	Environmental	Open in IMG/M
3300012668	Arctic soils microbial communities. Combined Assembly of 23 SPs	Environmental	Open in IMG/M
3300012981	Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DT8	Environmental	Open in IMG/M
3300013092	Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m	Environmental	Open in IMG/M
3300014205	Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 162 metaG	Engineered	Open in IMG/M
3300014270	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1	Environmental	Open in IMG/M
3300014300	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1	Environmental	Open in IMG/M
3300014322	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1	Environmental	Open in IMG/M
3300014323	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1	Environmental	Open in IMG/M
3300014814	Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocyanate-only bioreactor	Engineered	Open in IMG/M
3300014830	Activated sludge bacterial and viral communities from EBPR bioreactors in Brisbane, Australia - M92511	Engineered	Open in IMG/M
3300015208	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Samples st-15,16,16 pooled, 1st-3rd transect points, snow/rock/ice interface)	Environmental	Open in IMG/M
3300015370	Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - OS_PC_MetaG	Environmental	Open in IMG/M
3300018055	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex	Environmental	Open in IMG/M
3300019775	Lab enriched sediment microbial communities from hydrocarbon-contaminated retail site, Toronto, Canada - S1, HI.1247_001	Engineered	Open in IMG/M
3300022181	Enriched culture of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1	Engineered	Open in IMG/M
3300022553	Powell_combined assembly	Environmental	Open in IMG/M
3300024056	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction)	Environmental	Open in IMG/M
3300024973	Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_300_biof (SPAdes)	Engineered	Open in IMG/M
3300024978	Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_solids_1 (SPAdes)	Engineered	Open in IMG/M
3300024988	Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_inoc_plan (SPAdes)	Engineered	Open in IMG/M
3300025000	Soil microbial communities from Rifle, Colorado, USA - Groundwater E1	Environmental	Open in IMG/M
3300025153	Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - frozenSSSS metaG (SPAdes)	Environmental	Open in IMG/M
3300025525	Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_5A (SPAdes)	Environmental	Open in IMG/M
3300025856	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025963	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D2 (SPAdes)	Environmental	Open in IMG/M
3300026019	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_305 (SPAdes)	Environmental	Open in IMG/M
3300026349	Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PU6	Environmental	Open in IMG/M
3300026463	Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 CS6	Environmental	Open in IMG/M
3300027282	Deep subsurface microbial communities from Mt. Terri, Switzerland - Autotrophic microbial communities BRH/9 (SPAdes)	Environmental	Open in IMG/M
3300027283	Deep subsurface microbial communities from Mt. Terri, Switzerland - Autotrophic microbial communities BRH/37_all (SPAdes)	Environmental	Open in IMG/M
3300027675	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300027713	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300027721	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027723	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027726	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300027739	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes)	Environmental	Open in IMG/M
3300027740	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeq	Environmental	Open in IMG/M
3300027792	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027818	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027841	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes)	Environmental	Open in IMG/M
3300027871	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes)	Environmental	Open in IMG/M
3300027877	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)	Environmental	Open in IMG/M
3300027885	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)	Environmental	Open in IMG/M
3300027887	Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk	Environmental	Open in IMG/M
3300027890	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)	Environmental	Open in IMG/M
3300027955	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027972	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300028735	Hot spring microbial mat communities from Yellowstone National Park, WY, United States - YNP-CB-006-1	Environmental	Open in IMG/M
3300029892	Fracture fluid microbial communities from borehole on the 26 level of Beatrix Gold Mine, Welkom, South Africa - Be326_2011_MF	Environmental	Open in IMG/M
3300030613	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227	Environmental	Open in IMG/M
3300031578	Soil microbial communities from Risofladan, Vaasa, Finland - TR-2	Environmental	Open in IMG/M
3300032018	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle	Environmental	Open in IMG/M
3300032173	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top	Environmental	Open in IMG/M
3300032256	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top	Environmental	Open in IMG/M
3300033413	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT	Environmental	Open in IMG/M
3300033414	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B	Environmental	Open in IMG/M
3300033418	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033480	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B	Environmental	Open in IMG/M
3300033482	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C	Environmental	Open in IMG/M
3300033485	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A	Environmental	Open in IMG/M
3300033487	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A	Environmental	Open in IMG/M
3300033489	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214	Environmental	Open in IMG/M
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental	Open in IMG/M
3300033521	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B	Environmental	Open in IMG/M
3300034052	Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A4.2	Engineered	Open in IMG/M
3300034056	Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A3A4.3	Engineered	Open in IMG/M
3300034169	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.58
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.58
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F025775

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
MiccSRB6591170	2044078019	Concrete Drainage Pipe Biofilm	MKQLMTFQGFPMVLVVGLIVWAWISVLSVLVASFF
BS_KBA_SWE12_21mDRAFT_100105035	3300000124	Marine	MKQLLTFQGFPMVVVVAMIAWAWISLISVLIASFF*
Draft_1001249	3300000185	Hydrocarbon Resource Environments	MKQLLTFQGFPMVVVVGMIVWSWISVLSVLIASFF*
TB_PC08_66DRAFT_100036301	3300000228	Groundwater	MKQLLTFQGFPMVVVVGLILWAWISILSVLIGSFF*
TB_PC08_66DRAFT_100142781	3300000228	Groundwater	MKQLMTFQGFPMVLVVGLIVWAWVSVLSVLVASFF*
TB_PC08_66DRAFT_101240471	3300000228	Groundwater	MKQLFTFQGFPMVLVVGLILWAWISLLSVLIGSFF*
TB_PC08_66DRAFT_101531961	3300000228	Groundwater	MKQLMTFQNFPMVLVVGLIVWAWVSVLSVLVASFF*
TB_PC08_66DRAFT_101535422	3300000228	Groundwater	MKQLLTFQGFPLVVVVGLIVWAWISILSVLIGSFF*
TB_LI09_4DRAFT_101363852	3300000231	Groundwater	MKQLFTFQGFPMVVVVALIVWSWISIFSVLIAAFF*
WSSedA1Ba3DRAFT_11081791	3300000311	Wetland	MKQLLTFQGFPMVVVVGLIVWAWISILSVLVGSFF*
Draft_101232483	3300000558	Hydrocarbon Resource Environments	MKQLLTFQGFPMVVVVAFVVWSWFSILSVVIASFF*
Draft_103679542	3300000558	Hydrocarbon Resource Environments	MKQLFTFQGFPMLVVVGMIAWSWFSILSVLVASLF*
Draft_103753374	3300000558	Hydrocarbon Resource Environments	MKQLFTFQGFPMVVVVALIVWSWISVLSVLIASFF*
Draft_116884053	3300000558	Hydrocarbon Resource Environments	MKQLLTFQGFPMVVVVAFVVWSWISILSVLIASFF*
Draft_102128751	3300001592	Hydrocarbon Resource Environments	MNKLKFNDFNGVSEMKQLLTFQGFPMVIVTGMVIWSWISILSVVLASFF*
Draft_103601692	3300001592	Hydrocarbon Resource Environments	MKQLLTFQGFPMVVVVALIVWSWISILSVVIGSLF*
Draft_100028745	3300001605	Hydrocarbon Resource Environments	MKQLLTFQGFPMVVVVALIVWSWISILSVLVTSFF*
Draft_100233872	3300001605	Hydrocarbon Resource Environments	MKQLLTFQSFPMVVVTAMIIWAWISVFSVLIAAFF*
JGI24123J20310_100018825	3300001813	Serpentinite Rock And Fluid	MKQLFTFQGFPMVVVTAMIIWAWISVLSVLIASFF*
JGI26524J50256_10033821	3300003408	Wastewater Bioreactor	NFNGARTMKQLLTFQGFPMVVVTGLIVWAWISIFSVLIGSFF*
JGI26523J50269_10765421	3300003418	Wastewater Bioreactor	MKQLLTFQSFPMVVVTGLIIWAWISILSVLIARSSDVARA
Ga0055484_102255921	3300004066	Natural And Restored Wetlands	NFNGVRAMKQLLTFQGFPMVVVVAMVAWAWISLISVLIASFF*
Ga0055512_101178431	3300004072	Natural And Restored Wetlands	NKLKFSNLNGVQAMKQLLTFQGFPMVVVVAMVAWAWISLLSVLVASFF*
Ga0066599_1001454653	3300004282	Freshwater	LIGVRDMKQLMTFQGFPMVLVVGLILWAWISVLSVLIASFF*
Ga0079369_10147935	3300005643	Wastewater Bioreactor	MKQFLTFQRFPMVVVVALIVWSWISILSVVIGSLF*
Ga0079369_10159085	3300005643	Wastewater Bioreactor	MKQLLTFQSFPMVVVTGLIIWAWISILSVLIASFF*
Ga0079369_10274403	3300005643	Wastewater Bioreactor	MKQLLTFQGFPMVVVTALIVWAWISIFSVLIASFF*
Ga0079369_10356434	3300005643	Wastewater Bioreactor	MKQFLPFQGFPMVVVVALIVWSWISILSVVIGSLF*
Ga0079369_10632713	3300005643	Wastewater Bioreactor	MKQLLTFQGFPMVVVTGLIVWAWISIFSVLIGSFF*
Ga0079369_11124964	3300005643	Wastewater Bioreactor	MKQFLTFQGFPMVVVVALIVWSWISILSVVIGSLF*
Ga0079369_12673662	3300005643	Wastewater Bioreactor	MKQFLTFQGFPMVVVVALIVWSWISILSMVIGSLF*
Ga0079490_1000873	3300005794	Sediment	MKQFMSFQNFPMVVVTLMIIWAWISILSVLIASFF*
Ga0075275_10111982	3300005892	Rice Paddy Soil	MKQLLTFQGFPMVVVVGLIVWAWISILSVLIGSFF*
Ga0079037_1000115138	3300006224	Freshwater Wetlands	MKQLMTFQGFPMVLVVGLILWAWISVLSVLIASFF*
Ga0079037_1000417742	3300006224	Freshwater Wetlands	MKQLLTFQNFPMVVVTGLILWAWFSILSVLIASFF*
Ga0079037_1000662594	3300006224	Freshwater Wetlands	MKQLLTFQGFPMVVVVGLILWSWISILSVLIGSFF*
Ga0079037_1005150502	3300006224	Freshwater Wetlands	FNKFYGVRAMKQLLTFQGFPMVVVVGLILWSWISILSVLIGSFF*
Ga0079037_1010914132	3300006224	Freshwater Wetlands	MKQLLTFQGFPMVVVVGLVLWSWISILSVLIGSFF*
Ga0069787_104362005	3300006417	Enhanced Biological Phosphorus Removal Bioreactor	MKQLLTFQGFPMVVVVALIVWSWVSILSVVIGSLF*
Ga0069787_114441882	3300006417	Enhanced Biological Phosphorus Removal Bioreactor	MKQLLTFQGFPMVVVVGLIIWAWISILSVLIGSFF*
Ga0104349_10871693	3300007281	Aeration Tank Of Activated Sludge Process	MKQLLTFQGFPMVVVTGLIIWSWISILSVLIGSFF*
Ga0105105_100169585	3300009009	Freshwater Sediment	MNFNGVRAMKQLLTFQGFPMVVVVAMIAWAWISLISMLIASFF*
Ga0105105_100906833	3300009009	Freshwater Sediment	MKQLLTFQGFPMVVVVGLVAWAWISILSVLIGSFF*
Ga0105105_103827852	3300009009	Freshwater Sediment	MKQLLTFQGFPMVVVVAMIVWSWISVLSVLIASFF*
Ga0105093_100146554	3300009037	Freshwater Sediment	MKQLLTFQGFPMVVVVALIVWSWISIISVLVASFF*
Ga0105093_108461982	3300009037	Freshwater Sediment	MKQLFTFQNFPMLLVVGLIAWAWISILSVLIASIF*
Ga0105095_101061082	3300009053	Freshwater Sediment	MKQLLTFQGFPMVVVVGLIIWSWISVFSVLIGSFF*
Ga0105095_102527301	3300009053	Freshwater Sediment	MKQLLTFQGFPMVVVVALIVWSWISVLSVLIASFF*
Ga0105095_103034132	3300009053	Freshwater Sediment	MKQLFTFQGFPMVVVVALVVWSWISILSVLIAAFF*
Ga0105095_103204923	3300009053	Freshwater Sediment	MKQLLTFQGFPMVVVIGFVVWSWISLLSVLIASFF*
Ga0105095_103377102	3300009053	Freshwater Sediment	MKQLLTFQGFPMVVVVALVLWSWFSIFSVVIASFF*
Ga0105095_107199131	3300009053	Freshwater Sediment	MMKQLFTFQGFPMVVVVALIVWSWISIFSVLFASFF*
Ga0105095_108092542	3300009053	Freshwater Sediment	MKQLLTFQGFPMVVVAALIIWSWISIFSVLVASFF*
Ga0066256_100062621	3300009070	Wastewater Bioreactor	MKHLLTFQGFPMVVVIALIVWSWFSILSVIVAKLF*
Ga0105090_100344492	3300009075	Freshwater Sediment	MKQLLTFQGLPMVIVTGMIIWSWISILSVLVASFF*
Ga0105090_100407484	3300009075	Freshwater Sediment	MKQLLTFQGFPMVVVTALIIWAWISVLSVLIASFF*
Ga0105090_104163932	3300009075	Freshwater Sediment	MKQLLTFQGFPMVVVAAMIIWSWISILSVLIASFF*
Ga0105090_109538121	3300009075	Freshwater Sediment	MKQMMTFQNFPMVLVVGLIVWAWISVLSVLIASFF*
Ga0105106_107066772	3300009078	Freshwater Sediment	MKQLFTFQNFPMLLVVGLIAWAWISILSVLVASIF*
Ga0105106_107497592	3300009078	Freshwater Sediment	MKQLFTFQGFPMVVVTALIIWAWVSVISVLIASFF*
Ga0105106_113076443	3300009078	Freshwater Sediment	MKQLFTFQNFPMVVVTGLILWAWISILSVLITSFF*
Ga0105098_103372861	3300009081	Freshwater Sediment	MKQLLTFQGFPMVVVTAMIIWSWISILSVLIASFF*
Ga0105098_106863222	3300009081	Freshwater Sediment	MKQLLTFQGFPMVVVVAMIVWAWISLISMLIASFF*
Ga0105099_104507832	3300009082	Freshwater Sediment	MKQLLTFQGFPMVVVLAMIFWSWISVLSVLIASFF*
Ga0105099_106594292	3300009082	Freshwater Sediment	MKQLLTFQGFPMVVVVAMVAWAWISLISVLIASFF*
Ga0105099_110080172	3300009082	Freshwater Sediment	INGVRIMKQLLTFQGFPMVVVVALIVWSWISVLSVLIASFF*
Ga0105103_105296152	3300009085	Freshwater Sediment	MKQLMTFQGFPMVLVVGLIVWAWISVLSVLVASFF*
Ga0105107_101394692	3300009087	Freshwater Sediment	MKQLLTFQGFPMVVVVALIVWSWISVLSVLVASFF*
Ga0105107_102216581	3300009087	Freshwater Sediment	MKQLLTFQSFPMVVVVGMIIWAWISILSVLVASFF*
Ga0105107_102342891	3300009087	Freshwater Sediment	NFYGVRAMKQLLTFQGFPMVVVVGLIIWSWISVFSVLIGSFF*
Ga0105107_104006162	3300009087	Freshwater Sediment	MKQLMTFQNFPMVLVVGLIAWAWISVLSVLIASFF*
Ga0105107_105956582	3300009087	Freshwater Sediment	MKQLLTFQGFPMVVVVGLVIWSWISVFSVLVASFF*
Ga0115026_107284772	3300009111	Wetland	MKQLMTFQGFPMVVVVGLIVWAWISILSVLVGSFF*
Ga0115027_102468993	3300009131	Wetland	MKQLLTFQGFPMVVVVGLVIWSWISILSVLIASLF*
Ga0105091_100071652	3300009146	Freshwater Sediment	MKQLMTFQGFPMVLVVGLIVWSWISVLSVLVASFF*
Ga0105094_102698073	3300009153	Freshwater Sediment	MKQLLTFQGFPMVVVVAMIVWSWISVLSVLVASFF*
Ga0105094_106307672	3300009153	Freshwater Sediment	MKQLFTFQGFPMLVVVALVVWSWISILSVLFASLF*
Ga0105094_106570101	3300009153	Freshwater Sediment	RTNKLKFINFYGVRAMKQLLTFQGFPMVVVVGLIIWSWISVFSVLIGSFF*
Ga0105094_108164332	3300009153	Freshwater Sediment	MKQLLTFQGFPMVVVVGFVVWSWISVLSVLIASFF*
Ga0105094_109023502	3300009153	Freshwater Sediment	INFNGVRAMKQLLTFQGFPMVVVVAMIVWAWISLISMLIASFF*
Ga0105100_100088615	3300009166	Freshwater Sediment	MNFNGVRAMKQLLTFQGFPMVVVVAMIAWAWISLISVLIASFF*
Ga0105100_100120164	3300009166	Freshwater Sediment	MKQLFTFQGFPMVVVVAMIVWSWISVISVLIASFF*
Ga0105100_106602222	3300009166	Freshwater Sediment	MKQLFTFQGFPMLVVVALVVWSWISIFSVLFASFF*
Ga0105100_110306462	3300009166	Freshwater Sediment	MKQLLTFQGFPMVVVVALIVWSWISILSVLVASFL*
Ga0105097_106749043	3300009169	Freshwater Sediment	MKQLLTFQGFPMVVVTGMIIWAWISILSVLVASFF*
Ga0105097_107372122	3300009169	Freshwater Sediment	MKQLMTFQNFPMVLVVGLIAWAWISVLSVLVASFF*
Ga0105096_102686692	3300009170	Freshwater Sediment	MKQLLTFQGFPMVVVTAMIIWSWISILSVLVASFF*
Ga0105101_105358071	3300009171	Freshwater Sediment	RTNKLKFINFYGVRAMKQLLTFQGFPMVVVVGLVIWSWISVFSVLIASFF*
Ga0115028_113727612	3300009179	Wetland	KFNKFYGVRAMKQLLTFQGFPMVVVVGLILWSWISILSVLIGSFF*
Ga0124846_10017433	3300009416	Wastewater Bioreactor	MNQLLTFQGFPMVVVTGLIVWAWISIFSVLIGSFF*
Ga0124846_12077353	3300009416	Wastewater Bioreactor	NFNGARTMKQLLTFQGFPMVVVTGWIVWAWISIFSVLIGSFF*
Ga0118657_1000497319	3300009506	Mangrove Sediment	MKQLLTFQGFPMVVVVALIVWAWISILSVLIGSFF*
Ga0118657_100294286	3300009506	Mangrove Sediment	MKQYLTFQGFPMVVVVALIVWAWISILSVLIGSFF*
Ga0116141_101110132	3300009693	Anaerobic Digestor Sludge	MKQLLTFQGFPMVVVVGMIVWAWISILSVLIGSFF*
Ga0123337_100133184	3300009695	Glacier Valley	MKQLMTFQNFPMVLVVALITWAWISVLSVLIASFF*
Ga0116237_102771594	3300010356	Anaerobic Digestor Sludge	MEFSNMKQLLTFQGFPMVVVVGLIVWAWISILSVLIGSFF*
Ga0139299_11649891	3300011007	Basal Ice	MKQFMTFQGFPMVVVTLMIIWAWISILSVLIGSFF*
Ga0151623_10652998	3300011264	Sediment	MKQLLTFQGFPLVVVVGLIVWAWISLLSVLIGAFF*
Ga0151652_105514743	3300011340	Wetland	MKQLMTFQGFPMVLVVGLIVWAWISVLSVLIASFF*
Ga0157216_100343534	3300012668	Glacier Forefield Soil	VKKYMTFQNLPMVLVTLMIVGAWASIFSVLIASFF*
Ga0168316_1028934	3300012981	Weathered Mine Tailings	MKQLMTFQSFPMVVVTGMIIWAWISILSVLVASFF*
Ga0163199_100006654	3300013092	Freshwater	MNNLFTKYGFPMVVITALIVWAWISFISVLLGKLV*
Ga0172380_103314342	3300014205	Landfill Leachate	MKQLFTFQGFPMVVVVALVVWSWISIFSVLIAAFF*
Ga0172380_113142442	3300014205	Landfill Leachate	EFINFYGVRTMKQLFTFQGFPMVVVVALIVWSWISILSVLIAAFF*
Ga0075325_10797172	3300014270	Natural And Restored Wetlands	MKQLLTFQGFPMVVVVALIVWAWASIISVLIGSFF*
Ga0075321_10472272	3300014300	Natural And Restored Wetlands	MKQLLTFQGLPMVVVVGLIIWAWASILSVLIASFF*
Ga0075355_10176832	3300014322	Natural And Restored Wetlands	MKQLLTFQGFPMVVVVAMVAWAWISLLSVLVASFF*
Ga0075356_10781292	3300014323	Natural And Restored Wetlands	MKQLLTFQGFPMVLVVGMVIWAWISLLSVLVASFF*
Ga0075356_11751343	3300014323	Natural And Restored Wetlands	MKQLLTFQGFPMVVVVVMVAWAWISLLSVLVASFF*
Ga0119849_10147331	3300014814	Wastewater Bioreactor	ARTMKQLLTFQGFPMVVVTALIVWAWISIFSVLIASFF*
Ga0119906_11457241	3300014830	Activated Sludge	KFTNFFGARTMKQLLTFQGFPMVVVTGLIVWAWISIFSVLIGSFF*
Ga0167664_10259243	3300015208	Glacier Forefield Soil	MKQFMTFQGFPMVVVTLMIIWAWVSILSVLIGSFF*
Ga0180009_100458034	3300015370	Groundwater	MKQYLTFQGFPMVVVTLMIIWAWVSILSVLIGSFF*
Ga0180009_100937632	3300015370	Groundwater	MKQLFTFQGFPMVVVTGLIIWAWVSLLSVLIASFF*
Ga0180009_104393052	3300015370	Groundwater	LKSINFYGARTMKQLFTFQGFPMVVVTALIIWAWISVLSVLIASFF*
Ga0184616_100265363	3300018055	Groundwater Sediment	MKQLFTFQNFPMVVVTGLIVWAWISVLSVLIASFF
Ga0197853_101152688	3300019775	Enriched Sediment	MKRLLTFQGFPMVVVTALIVWAWISIFSVLIASFF
Ga0197853_1014544146	3300019775	Enriched Sediment	MKQLLTFQGFPMVVVWILVAWAWFSIFSVLIGSLF
Ga0197853_10218505	3300019775	Enriched Sediment	MKQLLTFQGFPMVVVVALIVWSWISILSVVIGSLF
Ga0197853_1043694120	3300019775	Enriched Sediment	MKQLFTFQGFPMVVVVALIVWSWISILSVLIAAFF
Ga0228535_100063371	3300022181	Defined Medium	MKQLLTFQGFPMVVVVGLIIWAWISILSVLIGSFF
Ga0212124_1000003895	3300022553	Freshwater	MNNLFTKYGFPMVVITALIVWAWISFISVLLGKLV
Ga0124853_11398212	3300024056	Freshwater Wetlands	MKQLMTFQGFPMVLVVGLILWAWISVLSVLIASFF
Ga0209959_10001192	3300024973	Wastewater Bioreactor	MKQLLTFQSFPMVVVTGLIIWAWISILSVLIASFF
Ga0209959_100036115	3300024973	Wastewater Bioreactor	MKQLLTFQGFPMVVVTALIVWAWISIFSVLIASFF
Ga0209959_100058106	3300024973	Wastewater Bioreactor	MKQLLTFQGFPMVVVTGLIVWAWISIFSVLIGSFF
Ga0209941_10476452	3300024978	Wastewater Bioreactor	MKQFLTFQGFPMVVVVALIVWSWISILSVVIGSLF
Ga0209958_100241312	3300024988	Wastewater Bioreactor	MKQFLTFQSFPMVVVVALIVWSWISILSVVIGSLF
Ga0209318_100264211	3300025000	Soil	MKQLLTFQGFPMVVVVGLIVWSWISILSVLIASFF
Ga0209512_10998183	3300025153	Glacier Valley	MKQLMTFQNFPMVLVVALITWAWISVLSVLIASFF
Ga0208244_10015330	3300025525	Serpentinite Rock And Fluid	MKQLFTFQGFPMVVVTAMIIWAWISVLSVLIASFF
Ga0208244_10030129	3300025525	Serpentinite Rock And Fluid	MKQLFTFQGFPMVVVVAMIVWSWISVISVLIASFF
Ga0208244_1050962	3300025525	Serpentinite Rock And Fluid	MKQLLTFQSFPMVVVTAMIVWAWISILSVLIGSFF
Ga0209604_11945942	3300025856	Anaerobic Digestor Sludge	MKQLLTFQGFPMVVVVGMIVWAWISILSVLIGSFF
Ga0210146_10021652	3300025963	Natural And Restored Wetlands	MKQLLTFQGFPMVVVVAMIAWAWISLISVLIASFF
Ga0208528_10171822	3300026019	Rice Paddy Soil	TNKLKLINFNGVRAMKQLLTFQGFPMVVVVGLIVWAWISILSVLIGSFF
Ga0256811_10080443	3300026349	Sediment	MKQLLTFQGFPMVVVVAMVAWAWISLISVLIASFF
Ga0256815_10152551	3300026463	Sediment	MKQLLTFQGFPMVVVVAMVAWAWISLLSVLVGSFF
Ga0209346_10249162	3300027282	Deep Subsurface	MKQFMTFQSFPMVVVTLMVIWAWVSILSVLIGSFF
Ga0209643_100003981	3300027283	Deep Surbsurface	MKQLFTFQGFPMVVVVALVVWSWISILSVLIAAFF
Ga0209077_10015558	3300027675	Freshwater Sediment	MKQLLTFQGFPMVVVVAMIVWSWISVLSVLIASFF
Ga0209077_10034103	3300027675	Freshwater Sediment	MKQLLTFQGFPMVVVTALIIWAWISVLSVLIASFF
Ga0209286_10222533	3300027713	Freshwater Sediment	MKQLLTFQGFPMVVVVALIVWSWISVLSVLIASFF
Ga0209286_10414373	3300027713	Freshwater Sediment	MKQLFTFQGFPMVVVTGLIVWAWVSVISVLIASFF
Ga0209286_12333691	3300027713	Freshwater Sediment	MKQLLTFQGFPMVVVTAMIIWAWISILSVLVASFF
Ga0209492_11064613	3300027721	Freshwater Sediment	MKQLLTFQGFPMVVVAAMIIWSWISILSVLIASFF
Ga0209703_10438793	3300027723	Freshwater Sediment	MKQLFTFQNFPMLLVVGLIAWAWISILSVLIASIF
Ga0209703_11661563	3300027723	Freshwater Sediment	MKQLLTFQGFPMVVVVALIVWSWISILSVLVASFL
Ga0209285_100990123	3300027726	Freshwater Sediment	MKQLLTFQGFPMVVVVALIVWSWISIISVLVASFF
Ga0209285_102325422	3300027726	Freshwater Sediment	NGVRAMKQLLTFQGFPMVVVVALIVWSWISILSVLVASFL
Ga0209575_101164043	3300027739	Freshwater	MKQLLTFQGFPMVVVVGLILWAWISILSVLIGSFF
Ga0214474_10250352	3300027740	Soil	MKQLLTFQGFPMVVVVGLVIWSWISVFSVLIASFF
Ga0209287_101947661	3300027792	Freshwater Sediment	VKTNKLKFINFYGVRAMKQLLTFQGFPMVVVTAMIIWAWISILSVLVASFF
Ga0209706_100055754	3300027818	Freshwater Sediment	MKQLLTFQGFPMVVVVALIVWSWISVLSVLVASFF
Ga0209706_101301371	3300027818	Freshwater Sediment	MKQLFTFQGFPMVVVTALIIGAWISVFSVLIASFF
Ga0209706_101914802	3300027818	Freshwater Sediment	KTNKLKFINFNGVRTMKQLLTFQGFPMVVVVALIVWSWISVLSVLIASFF
Ga0209706_104790432	3300027818	Freshwater Sediment	RTMKQLFTFQNFPMLLVVGLIAWAWISILSVLIASIF
Ga0209262_101663362	3300027841	Freshwater	MKQLLTFQGFPMVVVVGLILWAWISILSVLIASFF
Ga0209397_100238034	3300027871	Wetland	MKQLLTFQGFPMVVVVGLILWSWISILSVLIGSFF
Ga0209397_101809893	3300027871	Wetland	MKQLLTFQNFPMVVVTGLILWAWFSILSVLIASFF
Ga0209397_102006583	3300027871	Wetland	MKQLLTFQGFPMVVVVGLVLWSWISILSVLIGSFF
Ga0209293_104524551	3300027877	Wetland	LIGVCDMKQLMTFQGFPMVLVVGLILWAWISVLSVLIASFF
Ga0209450_107948391	3300027885	Freshwater Lake Sediment	AKTNKLKFINFNGVCAMKQLLTFQGFPMVVVVGLILWAWISILSVLIGSFF
Ga0208980_1000356911	3300027887	Wetland	MKQLLTFQGFPMVVVVGLIVWAWISILSVLVGSFF
Ga0208980_102874683	3300027887	Wetland	MKQLLTFQGFPMVVVVGLVLWSWISVLSVLIGSFF
Ga0209496_107225702	3300027890	Wetland	FYGVRAMKQLLTFQGFPMVVVVGLILWSWISILSVLIGSFF
Ga0209078_10779363	3300027955	Freshwater Sediment	MKQLFTFQGFPMVVVVAMIVWSWISVLSVLIASFF
Ga0209079_102512333	3300027972	Freshwater Sediment	MKQLLTFQGFPMVVVTAMIIWAWISILSVLIASFF
Ga0272446_100084224	3300028735	Microbial Mat	MKKFLTFQNFPMVLVVGLIVWAWISLLSVLAASLF
Ga0246235_1019534	3300029892	Fracture Fluid	MKQFLTFQGFPMVVVTALIVWAWISILSVLIASFF
Ga0299915_100392303	3300030613	Soil	MKQLLTFQGFPMVVVVGLVLWAWASILSVLVASFF
Ga0307376_1000001098	3300031578	Soil	MKQLFTFQGFPMVVVVALIVWSWISIFSVLIAAFF
Ga0315272_100207343	3300032018	Sediment	MKQYLTFQGAPMVLVIGLVLWAWISILSVLVGSFF
Ga0315272_101456921	3300032018	Sediment	VKTNKLKFINFNGVCVMKQLLTFQGFPMVVVVGLIIWAWISILSVLVGSFF
Ga0315272_107178132	3300032018	Sediment	HAMKQLLTFQGFPMVLVVGMIVWAWISLFSVLIAWLF
Ga0315268_1000185326	3300032173	Sediment	MKQLLTFQGFPMVVVVGLIIWAWISILSVLVGSFF
Ga0315271_100004482	3300032256	Sediment	MKQLLTFQGFPMVLVVGMIVWAWISLFSVLIAWLF
Ga0315271_106394322	3300032256	Sediment	MKQLMTFQNFPMVLVVGLITWAWISIISVLIGSFF
Ga0316603_109672652	3300033413	Soil	MKQLMTFQGFPMVLVVGLILWAWISVFSVLIASFF
Ga0316619_100114901	3300033414	Soil	SLTLIGVCDMKQLMTFQGFPMVLVVGLILWAWISVLSVLIASFF
Ga0316625_1000302414	3300033418	Soil	MKQLMTFQNFPMVLVIGLITWAWFSIISVLIGSFF
Ga0326726_100192733	3300033433	Peat Soil	MKQLLTFQGFPMVVVVVMVAWAWISLLSVLVASFF
Ga0316620_100079533	3300033480	Soil	MKQLLTFQGFPMVVVVGLIAWAWISILSVLIGSFF
Ga0316620_112855082	3300033480	Soil	MKQLMTFQGFPMVVVVGLIVWAWISILSVLVGSFF
Ga0316627_1000203214	3300033482	Soil	MKQLLTFQGFPMVVVVGLIAWAWISILSVLIASFF
Ga0316627_1000243674	3300033482	Soil	MKQLLTFQGFPMVVVVAMIIWAWISILSVLIGSFF
Ga0316626_103597222	3300033485	Soil	MMKQLFTFQGFPMVVVVALIVWSWISILSVLFASFF
Ga0316626_118315253	3300033485	Soil	MKKFMTFQGFPMVVVTAMIIWAWISVLSVLVASFF
Ga0316630_101014993	3300033487	Soil	MKQLMTFQNFPMVLVVGLIAWAWISVLSVLIASFF
Ga0299912_100046505	3300033489	Soil	MKQLLTFQGFPMVVVVALVIWSWISLFSVLVASFF
Ga0316628_1001341253	3300033513	Soil	MKQLLTFQGFPMVVVWGFIAWAWFSLLSVLIASLF
Ga0316628_1015846342	3300033513	Soil	MKQLLTFQGFPMVVVVGLILWAWISIFSVLIGSFF
Ga0316628_1027118691	3300033513	Soil	LKLVNLNGVRTMKQLLTFQGFPMVVVVGLIAWAWISILSVLIASFF
Ga0316628_1028042442	3300033513	Soil	MKQLLTFQGFPMVVVWGFVAWAWFSLLSVLIASLF
Ga0316616_1020014242	3300033521	Soil	MKQLMTFQGFPMVVVVGFIVWAWISILSVLIGSFF
Ga0316616_1021431121	3300033521	Soil	TMKQLLTFQGFPMVVVVGLILWAWISIFSVLIGSFF
Ga0316616_1024675601	3300033521	Soil	MKQLLTFQGFPMVVVIGFVVWSWISLLSVLIASFF
Ga0373889_007903_1073_1180	3300034052	Sediment Slurry	MKQLLTFQGFPMVVVIGMVIWSWISIISVLVASFF
Ga0373893_016983_27_134	3300034056	Sediment Slurry	MKQLLTFQGFPMVVVIGLVIWSWISILSVLVASFF
Ga0370480_0162832_594_701	3300034169	Untreated Peat Soil	MKQLLTFQGFPMIVVVGMIIWAWISILSVLMGSFF

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign