 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003418 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118793 | Gp0095075 | Ga0041896 |
| Sample Name | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_inoc_biof |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 171736237 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Wastewater Bioreactor Microbial Communities From Cape Town, South Africa |
| Type | Engineered |
| Taxonomy | Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | South Africa: Cape Town | |||||||
| Coordinates | Lat. (o) | -33.936637 | Long. (o) | 18.478905 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F025775 | Metagenome | 200 | Y |
| F027211 | Metagenome / Metatranscriptome | 195 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JGI26523J50269_1010362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 2043 | Open in IMG/M |
| JGI26523J50269_1076542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 509 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI26523J50269_1010362 | JGI26523J50269_10103622 | F027211 | MVRTYWFVPIFYEAIDILDLQPSARSDNVEACRPLGWCTTIVR* |
| JGI26523J50269_1076542 | JGI26523J50269_10765421 | F025775 | MKQLLTFQSFPMVVVTGLIIWAWISILSVLIARSSDVARA |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |