Basic Information | |
---|---|
IMG/M Taxon OID | 3300005643 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118793 | Gp0095085 | Ga0079369 |
Sample Name | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_750_biof (version 3) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 524145400 |
Sequencing Scaffolds | 7 |
Novel Protein Genes | 7 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 4 |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 2 |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Wastewater Bioreactor Microbial Communities From Cape Town, South Africa |
Type | Engineered |
Taxonomy | Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | South Africa: Cape Town | |||||||
Coordinates | Lat. (o) | -33.927 | Long. (o) | 18.452665 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F025775 | Metagenome | 200 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0079369_1014793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 4235 | Open in IMG/M |
Ga0079369_1015908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 4128 | Open in IMG/M |
Ga0079369_1027440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | 3344 | Open in IMG/M |
Ga0079369_1035643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 2984 | Open in IMG/M |
Ga0079369_1063271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus thioparus | 2258 | Open in IMG/M |
Ga0079369_1112496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 1608 | Open in IMG/M |
Ga0079369_1267366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 631 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0079369_1014793 | Ga0079369_10147935 | F025775 | MKQFLTFQRFPMVVVVALIVWSWISILSVVIGSLF* |
Ga0079369_1015908 | Ga0079369_10159085 | F025775 | MKQLLTFQSFPMVVVTGLIIWAWISILSVLIASFF* |
Ga0079369_1027440 | Ga0079369_10274403 | F025775 | MKQLLTFQGFPMVVVTALIVWAWISIFSVLIASFF* |
Ga0079369_1035643 | Ga0079369_10356434 | F025775 | MKQFLPFQGFPMVVVVALIVWSWISILSVVIGSLF* |
Ga0079369_1063271 | Ga0079369_10632713 | F025775 | MKQLLTFQGFPMVVVTGLIVWAWISIFSVLIGSFF* |
Ga0079369_1112496 | Ga0079369_11124964 | F025775 | MKQFLTFQGFPMVVVVALIVWSWISILSVVIGSLF* |
Ga0079369_1267366 | Ga0079369_12673662 | F025775 | MKQFLTFQGFPMVVVVALIVWSWISILSMVIGSLF* |
⦗Top⦘ |