Sample 3300014814

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300014814

3300014814: Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocyanate-only bioreactor

Overview

Basic Information
IMG/M Taxon OID	3300014814 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0118793 \| Gp0136317 \| Ga0119849
Sample Name	Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocyanate-only bioreactor
Sequencing Status	Permanent Draft
Sequencing Center	Banfield Lab, University of California, Berkeley
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	193900343
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Wastewater Bioreactor Microbial Communities From Cape Town, South Africa
Type	Engineered
Taxonomy	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline)

Location Information
Location	South Africa: University of Cape Town, Rondebosch
Coordinates	Lat. (^o)	-33.96	Long. (^o)	18.46	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025775	Metagenome	200	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0119849_1014733	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1828	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0119849_1014733	Ga0119849_10147331	F025775	ARTMKQLLTFQGFPMVVVTALIVWAWISIFSVLIASFF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.