Basic Information | |
---|---|
IMG/M Taxon OID | 3300014814 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118793 | Gp0136317 | Ga0119849 |
Sample Name | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocyanate-only bioreactor |
Sequencing Status | Permanent Draft |
Sequencing Center | Banfield Lab, University of California, Berkeley |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 193900343 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Wastewater Bioreactor Microbial Communities From Cape Town, South Africa |
Type | Engineered |
Taxonomy | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | South Africa: University of Cape Town, Rondebosch | |||||||
Coordinates | Lat. (o) | -33.96 | Long. (o) | 18.46 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F025775 | Metagenome | 200 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0119849_1014733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1828 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0119849_1014733 | Ga0119849_10147331 | F025775 | ARTMKQLLTFQGFPMVVVTALIVWAWISIFSVLIASFF* |
⦗Top⦘ |