NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300024988

3300024988: Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_inoc_plan (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300024988 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118793 | Gp0095076 | Ga0209958
Sample NameWastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_inoc_plan (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size341047186
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Erythrobacter/Porphyrobacter group → Erythrobacter → unclassified Erythrobacter → Erythrobacter sp. SG61-1L1
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → unclassified Planctomyces → Planctomyces sp.1
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameWastewater Bioreactor Microbial Communities From Cape Town, South Africa
TypeEngineered
TaxonomyEngineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationSouth Africa: Cape Town
CoordinatesLat. (o)-33.936637Long. (o)18.478905Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006009Metagenome / Metatranscriptome384Y
F009854Metagenome / Metatranscriptome312Y
F025775Metagenome200Y
F050494Metagenome / Metatranscriptome145Y
F065495Metagenome / Metatranscriptome127Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0209958_1002413All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans10545Open in IMG/M
Ga0209958_1015168All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Erythrobacter/Porphyrobacter group → Erythrobacter → unclassified Erythrobacter → Erythrobacter sp. SG61-1L2465Open in IMG/M
Ga0209958_1044278All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → unclassified Planctomyces → Planctomyces sp.1169Open in IMG/M
Ga0209958_1064409All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia876Open in IMG/M
Ga0209958_1088043All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia683Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0209958_1002413Ga0209958_100241312F025775MKQFLTFQSFPMVVVVALIVWSWISILSVVIGSLF
Ga0209958_1015168Ga0209958_10151682F006009MDTEPKMIWRGVAAGTVMGLGLGGILALFIALRPEMFAGLAG
Ga0209958_1044278Ga0209958_10442782F009854MNDRGARADVFTALQDLAEVIPEMRAGQLMAAVGELCADLHGRGLWDADDDEVLEAVWQFRRNYEAAAITN
Ga0209958_1064409Ga0209958_10644092F065495MLHRLTVGHLDVAAVERRQTVPVKALEMDVVHRLLGELGEKDDDGDVTLGGCKVKFENGAVSCLWMGGRANRVAEEFALRMHRETGCVIADVGGYRVIEPDELTGLTGQASGSKPGAVRT
Ga0209958_1088043Ga0209958_10880431F050494MSQRLTVHGRYVGRTFIPDGPLPDAEGAAELVITPTVPLSVGSIADAFGKATVLRSGDEILAQVRADRDEWDDR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.