Scaffold JGI24146J20443_1080684

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI24146J20443_1080684

Scaffold JGI24146J20443_1080684

Overview

Basic Information
Taxon OID	3300001868 Open in IMG/M
Scaffold ID	JGI24146J20443_1080684 Open in IMG/M
Source Dataset Name	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 11-31A
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	544
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location
Location Name	Barrow, Alaska, USA
Coordinates	Lat. (^o)	71.290884	Long. (^o)	-156.788063	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051098	Metagenome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24146J20443_10806841	F051098	AGGAGG	MILTPVYSCRNCKKTYSGSKQEIANVPIEKLVSAARYTLGSPDHIFRIGGKTIQLSDLHQCNANEIGLANFIKIQIG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.