Basic Information | |
---|---|
Taxon OID | 3300001988 Open in IMG/M |
Scaffold ID | JC3A454_101264 Open in IMG/M |
Source Dataset Name | Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP4 Joseph's Coat Springs |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1531 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → unclassified Pyrobaculum → Pyrobaculum sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Yellowstone National Park, WY | |||||||
Coordinates | Lat. (o) | 44.733519 | Long. (o) | -110.333 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F038745 | Metagenome / Metatranscriptome | 165 | Y |
F051572 | Metagenome / Metatranscriptome | 144 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JC3A454_1012642 | F051572 | N/A | MGRGPFADVRTFADVVLEGGCKKSLQFLKARLDLCVLAALVKAVPAGSMVKLRPGLVWRLAEELAAAAGRDRERVRNALLKRAGEVMARLRRELGDKAPAEALLARLAELFLEELEA* |
JC3A454_1012643 | F038745 | N/A | MDRAAVACGELMQVSLALSAYYPLCSGGPPCAFAESVERLVRRAASARGAEELVEVMGGRIRLEGLGLPAPALEALAEGLGPEPRWLDALAASFFRLYLGLHKRRRVDGRDLALALCLWAQKRRREDPGNPLWRAAELEPDRLYTEEEAREALGVEEALFRRLWRRALAFHRGEKAYGFQLILAALSLMAAPPRSV* |
⦗Top⦘ |