NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JC3A454_101264

Scaffold JC3A454_101264


Overview

Basic Information
Taxon OID3300001988 Open in IMG/M
Scaffold IDJC3A454_101264 Open in IMG/M
Source Dataset NameHot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP4 Joseph's Coat Springs
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1531
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → unclassified Pyrobaculum → Pyrobaculum sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location NameYellowstone National Park, WY
CoordinatesLat. (o)44.733519Long. (o)-110.333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038745Metagenome / Metatranscriptome165Y
F051572Metagenome / Metatranscriptome144N

Sequences

Protein IDFamilyRBSSequence
JC3A454_1012642F051572N/AMGRGPFADVRTFADVVLEGGCKKSLQFLKARLDLCVLAALVKAVPAGSMVKLRPGLVWRLAEELAAAAGRDRERVRNALLKRAGEVMARLRRELGDKAPAEALLARLAELFLEELEA*
JC3A454_1012643F038745N/AMDRAAVACGELMQVSLALSAYYPLCSGGPPCAFAESVERLVRRAASARGAEELVEVMGGRIRLEGLGLPAPALEALAEGLGPEPRWLDALAASFFRLYLGLHKRRRVDGRDLALALCLWAQKRRREDPGNPLWRAAELEPDRLYTEEEAREALGVEEALFRRLWRRALAFHRGEKAYGFQLILAALSLMAAPPRSV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.