Scaffold GOScombined01_100815772

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GOScombined01_100815772

Scaffold GOScombined01_100815772

Overview

Basic Information
Taxon OID	3300002040 Open in IMG/M
Scaffold ID	GOScombined01_100815772 Open in IMG/M
Source Dataset Name	GS000c - Sargasso Station 3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1630
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (20.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location Name	Moorea, Outside Cooks Bay, Polynesia Archipelagos
Coordinates	Lat. (^o)	-17.475834	Long. (^o)	-149.81223	Alt. (m)		Depth (m)	1.4
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093540	Metagenome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
GOScombined01_1008157724	F093540	AGG	MKMHLIKTNDDVLYEVIHQEPETKQIDAEKLKIKYYCTDVFRKDGQYWFVRKIEEAQVIEGNLENQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.