Scaffold JGIcombinedJ21913_10069605

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGIcombinedJ21913_10069605

Scaffold JGIcombinedJ21913_10069605

Overview

Basic Information
Taxon OID	3300002068 Open in IMG/M
Scaffold ID	JGIcombinedJ21913_10069605 Open in IMG/M
Source Dataset Name	Barrow Graham LP Ref core NGADG0004-212 (Barrow Graham LP Ref core NGADG0004-212,NGADG0011-311, ASSEMBLY_DATE=20131010)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1442
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (60.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location
Location Name	Barrow Environmental Observatory site, Barrow, Alaska, USA
Coordinates	Lat. (^o)	71.2905	Long. (^o)	-156.788708	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079373	Metagenome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
JGIcombinedJ21913_100696052	F079373	GAG	MKDTPSADPRDQAIRAALRDAATLAAMVVTEFRASYWGAERTVYVATLAAYVTDLGGRLEEAGTRDLVADXGXRRITVRFG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.