NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24538J26636_10029083

Scaffold JGI24538J26636_10029083


Overview

Basic Information
Taxon OID3300002154 Open in IMG/M
Scaffold IDJGI24538J26636_10029083 Open in IMG/M
Source Dataset NameMarine eukaryotic phytoplankton communities from the South Atlantic Ocean - 30m ANT-15 Metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1354
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Shirahamavirus → Shirahamavirus PTm1(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameSouth Atlantic Ocean
CoordinatesLat. (o)78.8697Long. (o)8.1122Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F084741Metagenome / Metatranscriptome112N
F087783Metagenome / Metatranscriptome110N

Sequences

Protein IDFamilyRBSSequence
JGI24538J26636_100290831F087783GGAMLQIGFSTKYFTLWDVQNETEYSGSEGQYSYXVTRFTYXQNLSLVEETAVAKAKEKGCTELGINDELRGRSGRSFEKRTPIKEEFELHQFTYGKYRGDDIRENTDVNYLKWYFNETELMLVAERVCELDSDYSIYENGLVTSEQLDNITKTNTIEAGLKKTGTIQLQMERNLDTYGFVQIDGIPYSFENYVERSYNGYGYGLPTLNGKAXRVXNKLIEVKVEFGVVGDWEMWKVTEWDFVK*
JGI24538J26636_100290833F084741N/AMIIIGFGLSIGTMNGFVQTYIGFAGVDNEMAFSFMGMMIGTLGIFAVDYKKLLIGLK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.