NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold B570J29617_1002065

Scaffold B570J29617_1002065


Overview

Basic Information
Taxon OID3300002375 Open in IMG/M
Scaffold IDB570J29617_1002065 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 21SEP2011 deep hole epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1062
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000450Metagenome / Metatranscriptome1126Y
F008305Metagenome / Metatranscriptome335Y

Sequences

Protein IDFamilyRBSSequence
B570J29617_10020651F008305AGGAMLGYTYKDIQNFGNSLTVAIDSASDPDVKQGLLTIWDFFEGLLAEGYIDEN
B570J29617_10020653F000450N/ADGAGDTICLYGHWAGYNMLGKLADAVIAARPRWTDESYATRIAISQLIGDQWNMETGWGLQVNSIGDNEHKIAVINWKDQTFSLHEQDDHRNLDNKVRGMKNEAIFTMDLSAFCEKYALERLLV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.