NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24187J35170_1004734

Scaffold JGI24187J35170_1004734


Overview

Basic Information
Taxon OID3300002491 Open in IMG/M
Scaffold IDJGI24187J35170_1004734 Open in IMG/M
Source Dataset NameAnoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant BLVA 2012
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5038
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (40.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.534Long. (o)-110.7978Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000642Metagenome / Metatranscriptome965Y
F000855Metagenome / Metatranscriptome859Y
F001381Metagenome / Metatranscriptome709Y
F002978Metagenome / Metatranscriptome516Y

Sequences

Protein IDFamilyRBSSequence
JGI24187J35170_100473410F002978GAGGMGSSLRDWRVILRPWADRRLWFVQARRNGRVVWGVVYDAADPESVVLVRRAVATLRAAGADCSALPSVLPGAPGSPSGA*
JGI24187J35170_10047347F000855GAGGMDWLEDFWSKIVSWSDELSASLYNAVVEWVNAVVEIWNGWMDALLHPADALPSVPQLRWVVDWLSDIVDYTALMYMLVDYVAYAQVVQQALVAQLTIVSIGLGFRAWLVIRRIVLVS*
JGI24187J35170_10047348F001381GAGMHYVIAFAYVLFWLSLAALAARWLPLWALPVALVQLAAAYVMLRAWLLTVAGRGDGDGA*
JGI24187J35170_10047349F000642N/AMQVVSIALAVCAVIAALWYMRRREAGAGRVRGWLLIWDELAGWRALQASYADAGIVADGVTYPASLPVVRVGRDLVWIARCDSAALVEHQALERARESAALASLWRGGGQWLDFLRVAGVVLPAVFSYFTWSQVAALQALVAQILSLVGEGK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.