NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24187J35170_1018681

Scaffold JGI24187J35170_1018681


Overview

Basic Information
Taxon OID3300002491 Open in IMG/M
Scaffold IDJGI24187J35170_1018681 Open in IMG/M
Source Dataset NameAnoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant BLVA 2012
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1700
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Halobacteriales → Halobacteriaceae → Haladaptatus → Haladaptatus paucihalophilus → Haladaptatus paucihalophilus DX253(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.534Long. (o)-110.7978Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004367Metagenome / Metatranscriptome441Y

Sequences

Protein IDFamilyRBSSequence
JGI24187J35170_10186812F004367AGGAGGMDNGTARNERDRSEAWVESLLTNAGASVGRLLDDRQVNAVSLALEVFAYLLAALPADRVEVRDVIKLLKYFSRGVNNAKGEQG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.